PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0259s00170.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MIKC_MADS
Protein Properties Length: 214aa    MW: 24131.5 Da    PI: 8.5756
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0259s00170.2genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.3e-32959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Vang0259s00170.2  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                      79***********************************************96 PP

2K-box47.29.3e-17931341657
             K-box  16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqq 57 
                       s+qqe+ kLk+++e Lqr+qR+l+GedL++Ls keL++Le++
  Vang0259s00170.2  93 SSQQEYLKLKARYEALQRSQRNLMGEDLGPLSSKELESLERH 134
                       689*************************************74 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
CDDcd002652.97E-46276No hitNo description
SuperFamilySSF554558.24E-34275IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-33323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004046.4E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.1691183IPR002487Transcription factor, K-box
PfamPF014862.3E-1193134IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0048481Biological Processplant ovule development
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SSMLKTLERY QKCNYGAPEA NVSTREALVM ELSSQQEYLK LKARYEALQR SQRNLMGEDL  120
GPLSSKELES LERHEANRSL RQRQLEGYQI NPLQLNPGVE DMGYGRHPAQ AQGDALFQPL  180
ECEPTLQIGY QPDPVSVVTA GPSMSNYMAG WLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A8e-2775142167Developmental protein SEPALLATA 3
4ox0_B8e-2775142167Developmental protein SEPALLATA 3
4ox0_C8e-2775142167Developmental protein SEPALLATA 3
4ox0_D8e-2775142167Developmental protein SEPALLATA 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00605ChIP-seqTransfer from AT1G24260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapVang0259s00170.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0936170.0BT093617.1 Soybean clone JCVI-FLGm-17F9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014522692.11e-149MADS-box transcription factor 1 isoform X1
SwissprotQ8LLR01e-127MADS4_VITVI; Agamous-like MADS-box protein MADS4
TrEMBLA0A1S3VWX41e-148A0A1S3VWX4_VIGRR; MADS-box transcription factor 1 isoform X1
STRINGGLYMA05G28140.31e-144(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.21e-107MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]