PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang0254s00140.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 137aa MW: 15499.7 Da PI: 4.3305 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 27.4 | 7.7e-09 | 3 | 33 | 1 | 31 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartm 31 +g+WT+ Ed ll ++++ +G g+Wk+ +++ Vang0254s00140.1 3 KGPWTPKEDALLTKYIQAHGEGQWKSLPKKA 33 79************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.427 | 1 | 43 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-10 | 2 | 33 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.02E-7 | 2 | 32 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-6 | 3 | 32 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.66E-5 | 5 | 32 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
LHKGPWTPKE DALLTKYIQA HGEGQWKSLP KKADSNNTYT FDSNSASAST NQEKEESPLT 60 KESNLASEFR NVGESDDFGF FSEDHDLVNA SDMECHSYFP SDHGSLQQLY EEYYHLLNMD 120 HSQFIEMSSF GESLFT* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang0254s00140.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015042 | 1e-174 | AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017405792.1 | 2e-68 | PREDICTED: transcription repressor MYB6-like | ||||
TrEMBL | A0A0L9T5U7 | 5e-68 | A0A0L9T5U7_PHAAN; Uncharacterized protein | ||||
STRING | XP_007135274.1 | 1e-51 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF27147 | 3 | 3 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49330.1 | 4e-11 | myb domain protein 111 |