PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Vang0071ss00600.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 112aa MW: 12950.1 Da PI: 10.147 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 49.5 | 9.7e-16 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ed++l ++++ +G g W+ +++ g++R++k+c++rw++yl Vang0071ss00600.3 14 KGAWTALEDKILTEYINVHGEGKWRHLPKRAGLKRCGKSCRLRWLNYL 61 79*********************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 8.3E-23 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 21.316 | 9 | 65 | IPR017930 | Myb domain |
SMART | SM00717 | 1.8E-12 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.3E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.8E-22 | 15 | 90 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.71E-9 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 5.6E-8 | 65 | 89 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MGRSPCCSKE GLNKGAWTAL EDKILTEYIN VHGEGKWRHL PKRAGLKRCG KSCRLRWLNY 60 LRPGIKRGNI TNDEEELIIR LHNLLGNRYI YRHYSTCFSV FLLIITNFLS L* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 1e-13 | 12 | 89 | 25 | 101 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Vang0071ss00600.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015042 | 1e-112 | AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014515267.1 | 4e-58 | myb-related protein 308-like | ||||
Refseq | XP_017405902.1 | 9e-59 | PREDICTED: transcription factor MYB3-like | ||||
Refseq | XP_027337331.1 | 1e-58 | transcription factor MYB8-like | ||||
Swissprot | P10290 | 2e-42 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
TrEMBL | A0A0L9T6S2 | 2e-57 | A0A0L9T6S2_PHAAN; Uncharacterized protein | ||||
STRING | XP_007135450.1 | 2e-57 | (Phaseolus vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G16720.1 | 3e-43 | myb domain protein 7 |