PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678455611 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 247aa MW: 28051.9 Da PI: 8.9893 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 156.8 | 9.2e-49 | 31 | 153 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100 lppGfrFhPtdeelv +yL++kv + ++++ ++i+e+d ++++PwdLp +e+e yfF++++ ky++g+r+nrat+ gyWkatg dk++++ ++++v 678455611 31 LPPGFRFHPTDEELVLQYLRRKVFSFPVPA-SIIPEFDANRSDPWDLPG---DTEQERYFFCRKEIKYPNGSRSNRATAGGYWKATGLDKQIVV-RNHVV 125 79***************************9.89***************3...457899************************************.999** PP NAM 101 glkktLvfykgrapkgektdWvmheyrl 128 g+kktLvfy g+ pkg ktdWv+heyrl 678455611 126 GMKKTLVFYLGKPPKGCKTDWVLHEYRL 153 **************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.75E-57 | 24 | 179 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 53.751 | 31 | 179 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.0E-26 | 32 | 153 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MASCSTPRST RPSSVSATQM EQPQNTIISR LPPGFRFHPT DEELVLQYLR RKVFSFPVPA 60 SIIPEFDANR SDPWDLPGDT EQERYFFCRK EIKYPNGSRS NRATAGGYWK ATGLDKQIVV 120 RNHVVGMKKT LVFYLGKPPK GCKTDWVLHE YRLLNAACQG TLAPLPVEET WVLCRMLLKK 180 RRSTKGNVTE PRRKEQGFVF YDFMAKEKAD SSSGSSGVTQ ILIRKQEQED EEEEAESSSC 240 GNSFTVI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-48 | 31 | 185 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-48 | 31 | 185 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-48 | 31 | 185 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-48 | 31 | 185 | 17 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-48 | 31 | 185 | 20 | 174 | NAC domain-containing protein 19 |
3swm_B | 3e-48 | 31 | 185 | 20 | 174 | NAC domain-containing protein 19 |
3swm_C | 3e-48 | 31 | 185 | 20 | 174 | NAC domain-containing protein 19 |
3swm_D | 3e-48 | 31 | 185 | 20 | 174 | NAC domain-containing protein 19 |
3swp_A | 3e-48 | 31 | 185 | 20 | 174 | NAC domain-containing protein 19 |
3swp_B | 3e-48 | 31 | 185 | 20 | 174 | NAC domain-containing protein 19 |
3swp_C | 3e-48 | 31 | 185 | 20 | 174 | NAC domain-containing protein 19 |
3swp_D | 3e-48 | 31 | 185 | 20 | 174 | NAC domain-containing protein 19 |
4dul_A | 2e-48 | 31 | 185 | 17 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-48 | 31 | 185 | 17 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678455611 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011086848.1 | 4e-92 | NAC domain-containing protein 83 | ||||
Swissprot | Q9FY93 | 3e-71 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A2G9H1C1 | 4e-91 | A0A2G9H1C1_9LAMI; Uncharacterized protein | ||||
STRING | GLYMA18G53954.1 | 2e-89 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1387 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 6e-73 | NAC domain containing protein 83 |
Publications ? help Back to Top | |||
---|---|---|---|
|