PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678438975 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 132aa MW: 14919.6 Da PI: 6.356 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 45.5 | 1.6e-14 | 30 | 88 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+++NR +ArrsR+RK++ ++eL++++ L +eN++ + l+ + + +++se+ 678438975 30 RKRKRMISNRDSARRSRLRKQQHLDELTREATRLRKENHDFITSLNAVTHYYINMESEN 88 6789*****************************************99999998888887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.3E-17 | 26 | 90 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.117 | 28 | 91 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.43E-11 | 30 | 82 | No hit | No description |
Pfam | PF00170 | 1.3E-12 | 30 | 88 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 3.9E-10 | 30 | 103 | No hit | No description |
CDD | cd14702 | 8.69E-15 | 31 | 79 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 33 | 48 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MDSSSGVSSN SPGVQASSPE EDLRVVMEER KRKRMISNRD SARRSRLRKQ QHLDELTREA 60 TRLRKENHDF ITSLNAVTHY YINMESENAV LRAQASELTQ WLHSLHEMIA FSGGSGGGAD 120 DDFLLLEPVY GI |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 42 | 48 | RRSRLRK |
2 | 42 | 49 | RRSRLRKQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678438975 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022762120.1 | 1e-40 | bZIP transcription factor 11-like | ||||
TrEMBL | A0A2P6PPH4 | 2e-37 | A0A2P6PPH4_ROSCH; Putative transcription factor bZIP family | ||||
STRING | XP_004289640.1 | 1e-38 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA537 | 24 | 123 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G75390.1 | 2e-27 | basic leucine-zipper 44 |