PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678434817
Organism
Utricularia gibba
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 86aa    MW: 9974.97 Da    PI: 5.0613
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678434817genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM583.2e-181561249
        NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
               ppGfrFhPtdeelv +yLk+kv +k+++  ++i e+d+yk++P++Lp 
  678434817 15 PPGFRFHPTDEELVGYYLKRKVCRKRHHR-DMIGETDVYKCDPEELPG 61
               9*************************998.99**************94 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-181263IPR003441NAC domain
PROSITE profilePS5100518.9661486IPR003441NAC domain
PfamPF023654.7E-101583IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MGLDSDCTDY GSDFPPGFRF HPTDEELVGY YLKRKVCRKR HHRDMIGETD VYKCDPEELP  60
GGFSYSSVNV DLSPRSLFPW FAFLLX
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Transcriptional activator that acts as positive regulator of AOX1A during mitochondrial dysfunction. Binds directly to AOX1A promoter. Mediates mitochondrial retrograde signaling. {ECO:0000269|PubMed:24045017}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678434817
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold and drought stresses. {ECO:0000269|PubMed:17158162}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074130.11e-24NAC domain-containing protein 17-like
SwissprotQ9XIC58e-19NAC17_ARATH; NAC domain-containing protein 17
TrEMBLA0A022R8F51e-21A0A022R8F5_ERYGU; Uncharacterized protein
STRINGMigut.N02932.1.p2e-22(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.13e-21NAC domain containing protein 17
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Van Aken O, et al.
    Mitochondrial and Chloroplast Stress Responses Are Modulated in Distinct Touch and Chemical Inhibition Phases.
    Plant Physiol., 2016. 171(3): p. 2150-65
    [PMID:27208304]
  3. Van Aken O,Ford E,Lister R,Huang S,Millar AH
    Retrograde signalling caused by heritable mitochondrial dysfunction is partially mediated by ANAC017 and improves plant performance.
    Plant J., 2016. 88(4): p. 542-558
    [PMID:27425258]
  4. Hu Z, et al.
    Mitochondrial Defects Confer Tolerance against Cellulose Deficiency.
    Plant Cell, 2016. 28(9): p. 2276-2290
    [PMID:27543091]
  5. Chi YH, et al.
    The membrane-tethered NAC transcription factor, AtNTL7, contributes to ER-stress resistance in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2017. 488(4): p. 641-647
    [PMID:28088515]
  6. Van Aken O,Pogson BJ
    Convergence of mitochondrial and chloroplastic ANAC017/PAP-dependent retrograde signalling pathways and suppression of programmed cell death.
    Cell Death Differ., 2017. 24(6): p. 955-960
    [PMID:28498364]
  7. Cheng P, et al.
    The ERA-Related GTPase AtERG2 Associated with Mitochondria 18S RNA Is Essential for Early Embryo Development in Arabidopsis.
    Front Plant Sci, 2018. 9: p. 182
    [PMID:29497438]