PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678415743 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 96aa MW: 10584.8 Da PI: 4.8996 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 87.3 | 2e-27 | 34 | 93 | 2 | 61 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl k+y++++d+++++++sws+++nsfvv+d+ efa+++LpkyFkhsnf+SFvRQLn+Y 678415743 34 FLVKTYDMVDDPSTDKIVSWSSTNNSFVVWDSAEFARDLLPKYFKHSNFSSFVRQLNTYV 93 9**********************************************************5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 1.7E-29 | 26 | 94 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 9.93E-25 | 29 | 93 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 7.7E-24 | 30 | 94 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 8.1E-23 | 34 | 93 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.2E-16 | 34 | 57 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.2E-16 | 72 | 84 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.2E-16 | 85 | 96 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MEASSNSSAV LDGGDGGRSA LPHPMPAANG PPPFLVKTYD MVDDPSTDKI VSWSSTNNSF 60 VVWDSAEFAR DLLPKYFKHS NFSSFVRQLN TYVWLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 8e-22 | 26 | 92 | 18 | 87 | Heat shock factor protein 1 |
5d5v_B | 8e-22 | 26 | 92 | 18 | 87 | Heat shock factor protein 1 |
5d5v_D | 8e-22 | 26 | 92 | 18 | 87 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678415743 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:7948881}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015160909.1 | 2e-40 | PREDICTED: heat shock factor protein HSF8 isoform X1 | ||||
Refseq | XP_015160911.1 | 2e-40 | PREDICTED: heat shock factor protein HSF8 isoform X2 | ||||
Swissprot | P41151 | 2e-32 | HFA1A_ARATH; Heat stress transcription factor A-1a | ||||
TrEMBL | S8CTT4 | 1e-46 | S8CTT4_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | XP_009781208.1 | 4e-38 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA572 | 24 | 113 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G17750.1 | 6e-32 | heat shock factor 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|