PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678404192 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 141aa MW: 15737.1 Da PI: 8.6816 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 135.9 | 1.5e-42 | 7 | 106 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +CaaCk lrrkC+++Cv+apyfp ++p+kf nvhk+FGasnv+k+l++l++++reda++sl+yeAe r+rdP+yG+vg+i+ lqq+l+ ++ +l+l+k+ 678404192 7 PCAACKCLRRKCTQECVFAPYFPPDNPQKFTNVHKVFGASNVTKILNELSPSQREDAVNSLAYEAESRLRDPIYGCVGIISLLQQRLMVVRGKLELAKKD 106 7*****************************************************************************************9999998875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 26.436 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 5.3E-42 | 7 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MSCSNSPCAA CKCLRRKCTQ ECVFAPYFPP DNPQKFTNVH KVFGASNVTK ILNELSPSQR 60 EDAVNSLAYE AESRLRDPIY GCVGIISLLQ QRLMVVRGKL ELAKKDLATY IGPQSMMPTL 120 NHPGFIQQQQ QQQQGQGLYG Q |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 5e-49 | 4 | 110 | 8 | 114 | LOB family transfactor Ramosa2.1 |
5ly0_B | 5e-49 | 4 | 110 | 8 | 114 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678404192 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020554582.1 | 5e-73 | LOB domain-containing protein 36 | ||||
Swissprot | Q9FKZ3 | 5e-63 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | A0A2Z7CRQ8 | 8e-75 | A0A2Z7CRQ8_9LAMI; LOB domain-containing protein 36-like | ||||
STRING | Solyc02g065150.1.1 | 6e-68 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA43 | 24 | 669 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66870.1 | 4e-65 | ASYMMETRIC LEAVES 2-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|