PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678312885 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 212aa MW: 23231.1 Da PI: 8.301 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.6 | 1.4e-18 | 12 | 57 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W+ +Ed lv++v+++G+++W++I+++++ +R++k+c++rw + 678312885 12 KGPWSSDEDAALVKLVAEYGPRNWSLISAHIP-RRSGKSCRLRWCNQ 57 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 49.5 | 9.5e-16 | 65 | 108 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+eEd + a++ G++ W++Iar ++ gRt++ +k++w++ 678312885 65 SPFTPEEDAVIMAAHAVNGNR-WAAIARLLP-GRTDNAIKNHWHST 108 58*******************.*********.***********976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.142 | 7 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.15E-30 | 10 | 105 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.4E-16 | 11 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.6E-18 | 12 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-24 | 13 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.86E-15 | 14 | 56 | No hit | No description |
SMART | SM00717 | 5.9E-13 | 63 | 111 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 21.607 | 63 | 113 | IPR017930 | Myb domain |
CDD | cd00167 | 1.87E-10 | 66 | 109 | No hit | No description |
Pfam | PF00249 | 3.7E-13 | 66 | 107 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.8E-22 | 66 | 112 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
MEINGGGRER IKGPWSSDED AALVKLVAEY GPRNWSLISA HIPRRSGKSC RLRWCNQLSP 60 AVHHSPFTPE EDAVIMAAHA VNGNRWAAIA RLLPGRTDNA IKNHWHSTLK RKRSPGSGGS 120 SESGIKRQCS WASQEHDSYP GDETLQSGLN GADADDGLTL VLFPPRAEAD PTAETADTRF 180 MKTIKKIIAE EVRNCIRGLC ANIPCNLPQC QN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-40 | 9 | 112 | 1 | 104 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678312885 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011084888.1 | 1e-69 | transcription factor MYB1-like | ||||
Swissprot | Q9SN12 | 6e-49 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A022RUN7 | 3e-63 | A0A022RUN7_ERYGU; Uncharacterized protein | ||||
STRING | Migut.F01484.1.p | 6e-64 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA12883 | 16 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 5e-51 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|