Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 62.4 | 9.5e-20 | 6 | 51 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+g+W++eEde+l + v+++G+++W++I++ ++ gR++k+c++rw +
AT3G50060.1 6 KGPWSQEEDEQLRRMVEKYGPRNWSAISKSIP-GRSGKSCRLRWCNQ 51
79******************************.***********985 PP
|
2 | Myb_DNA-binding | 53.2 | 6.8e-17 | 60 | 102 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
++++eEde +v a +q+G++ W+tIar ++ gRt++ +k++w++
AT3G50060.1 60 PFSPEEDETIVTARAQFGNK-WATIARLLN-GRTDNAVKNHWNST 102
89******************.*********.***********986 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Menges M,Hennig L,Gruissem W,Murray JA
Cell cycle-regulated gene expression in Arabidopsis. J. Biol. Chem., 2002. 277(44): p. 41987-2002 [PMID:12169696] - Kersten B, et al.
Generation of Arabidopsis protein chips for antibody and serum screening. Plant Mol. Biol., 2003. 52(5): p. 999-1010 [PMID:14558660] - Shin R,Schachtman DP
Hydrogen peroxide mediates plant root cell response to nutrient deprivation. Proc. Natl. Acad. Sci. U.S.A., 2004. 101(23): p. 8827-32 [PMID:15173595] - Ko JH,Han KH,Park S,Yang J
Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] - Teige M, et al.
The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis. Mol. Cell, 2004. 15(1): p. 141-52 [PMID:15225555] - Guan Y,Nothnagel EA
Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] - Lee D,Polisensky DH,Braam J
Genome-wide identification of touch- and darkness-regulated Arabidopsis genes: a focus on calmodulin-like and XTH genes. New Phytol., 2005. 165(2): p. 429-44 [PMID:15720654] - Suzuki N, et al.
Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c. Plant Physiol., 2005. 139(3): p. 1313-22 [PMID:16244138] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Ma S,Gong Q,Bohnert HJ
Dissecting salt stress pathways. J. Exp. Bot., 2006. 57(5): p. 1097-107 [PMID:16510518] - Zheng W, et al.
Bestatin, an inhibitor of aminopeptidases, provides a chemical genetics approach to dissect jasmonate signaling in Arabidopsis. Plant Physiol., 2006. 141(4): p. 1400-13 [PMID:16798948] - Shin R, et al.
The Arabidopsis transcription factor MYB77 modulates auxin signal transduction. Plant Cell, 2007. 19(8): p. 2440-53 [PMID:17675404] - Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] - Ferreira FJ,Guo C,Coleman JR
Reduction of plastid-localized carbonic anhydrase activity results in reduced Arabidopsis seedling survivorship. Plant Physiol., 2008. 147(2): p. 585-94 [PMID:18434607] - Wang Y, et al.
Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] - Causier B,Ashworth M,Guo W,Davies B
The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Lumba S, et al.
A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis. Dev. Cell, 2014. 29(3): p. 360-72 [PMID:24823379] - Zhao Y, et al.
The ABA receptor PYL8 promotes lateral root growth by enhancing MYB77-dependent transcription of auxin-responsive genes. Sci Signal, 2014. 7(328): p. ra53 [PMID:24894996] - Kranz HD, et al.
Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]
|