PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G50060.1

Common Name

F3A4.140, MYB77

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 301aa MW: 33111.1 Da PI: 6.3094

Description

myb domain protein 77

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G50060.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	62.4	9.5e-20	6	51	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde+l + v+++G+++W++I++ ++ gR++k+c++rw + AT3G50060.1 6 KGPWSQEEDEQLRRMVEKYGPRNWSAISKSIP-GRSGKSCRLRWCNQ 51 79****************************.*********985 PP
2	Myb_DNA-binding	53.2	6.8e-17	60	102	3	47
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++eEde +v a +q+G++ W+tIar ++ gRt++ +k++w++ AT3G50060.1 60 PFSPEEDETIVTARAQFGNK-WATIARLLN-GRTDNAVKNHWNST 102 89****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	29.985	1	56	IPR017930	Myb domain
SuperFamily	SSF46689	2.08E-31	3	99	IPR009057	Homeodomain-like
SMART	SM00717	3.2E-18	5	54	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-19	6	51	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.1E-26	7	59	IPR009057	Homeodomain-like
CDD	cd00167	6.43E-18	8	50	No hit	No description
SMART	SM00717	4.2E-14	57	105	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.232	58	107	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	9.5E-22	60	106	IPR009057	Homeodomain-like
CDD	cd00167	1.90E-11	60	103	No hit	No description
Pfam	PF00249	1.2E-13	60	102	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009723	Biological Process	response to ethylene
GO:0009751	Biological Process	response to salicylic acid
GO:0010200	Biological Process	response to chitin
GO:0030154	Biological Process	cell differentiation
GO:0048527	Biological Process	lateral root development
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0003011	anatomy	root vascular system
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020123	anatomy	root cap
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025195	anatomy	pollen tube cell
PO:0025256	anatomy	lateral root elongation zone
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 301 aa Download sequence Send to blast
MADRVKGPWS QEEDEQLRRM VEKYGPRNWS AISKSIPGRS GKSCRLRWCN QLSPEVEHRP 60 FSPEEDETIV TARAQFGNKW ATIARLLNGR TDNAVKNHWN STLKRKCSGG VAVTTVTETE 120 EDQDRPKKRR SVSFDSAFAP VDTGLYMSPE SPNGIDVSDS STIPSPSSPV AQLFKPMPIS 180 GGFTVVPQPL PVEMSSSSED PPTSLSLSLP GAENTSSSHN NNNNALMFPR FESQMKINVE 240 ERGEGRRGEF MTVVQEMIKA EVRSYMAEMQ KTSGGFVVGG LYESGGNGGF RDCGVITPKV 300 E

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	5e-39	5	107	3	105	MYB PROTO-ONCOGENE PROTEIN
1mse_C	4e-39	5	107	3	105	C-Myb DNA-Binding Domain
1msf_C	4e-39	5	107	3	105	C-Myb DNA-Binding Domain
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.22600	0.0	flower\| root\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	186510860	0.0
Genevisible	252193_at	0.0
Expression Atlas	AT3G50060	-
AtGenExpress	AT3G50060	-
ATTED-II	AT3G50060	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269\|PubMed:9678577}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269\|PubMed:17675404, ECO:0000269\|PubMed:9678577}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the R2R3 transcription factor gene family. Expressed in response to potassium deprivation and auxin. Involved in lateral root development. Interacts with ARF7 and regulates the expression of some auxin responsive genes.
UniProt	Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269\|PubMed:17675404, ECO:0000269\|PubMed:24894996}.

Function -- GeneRIF ? help Back to Top
A new Arabidopsis thaliana transcription factor, MYB77, that is involved in auxin response, is reported.[MYB77] [PMID: 17675404]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00400	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G50060.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269\|PubMed:15173595, ECO:0000269\|PubMed:17675404}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G50060, AT1G10585

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G50060

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF424588	0.0	AF424588.1 Arabidopsis thaliana AT3g50060/F3A4_140 mRNA, complete cds.
GenBank	AL132978	0.0	AL132978.1 Arabidopsis thaliana DNA chromosome 3, BAC clone F3A4.
GenBank	AY124828	0.0	AY124828.1 Arabidopsis thaliana AT3g50060/F3A4_140 mRNA, complete cds.
GenBank	AY519598	0.0	AY519598.1 Arabidopsis thaliana MYB transcription factor (At3g50060) mRNA, complete cds.
GenBank	CP002686	0.0	CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_190575.1	0.0	myb domain protein 77
Swissprot	Q9SN12	0.0	MYB77_ARATH; Transcription factor MYB77
TrEMBL	A0A1D9CFQ2	0.0	A0A1D9CFQ2_MAIZE; MYB transcription factor
STRING	AT3G50060.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM13598	15	27
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT3G50060.1
Entrez Gene	824168
iHOP	AT3G50060
wikigenes	AT3G50060

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Menges M,Hennig L,Gruissem W,Murray JA Cell cycle-regulated gene expression in Arabidopsis. J. Biol. Chem., 2002. 277(44): p. 41987-2002 [PMID:12169696] Kersten B, et al. Generation of Arabidopsis protein chips for antibody and serum screening. Plant Mol. Biol., 2003. 52(5): p. 999-1010 [PMID:14558660] Shin R,Schachtman DP Hydrogen peroxide mediates plant root cell response to nutrient deprivation. Proc. Natl. Acad. Sci. U.S.A., 2004. 101(23): p. 8827-32 [PMID:15173595] Ko JH,Han KH,Park S,Yang J Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] Teige M, et al. The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis. Mol. Cell, 2004. 15(1): p. 141-52 [PMID:15225555] Guan Y,Nothnagel EA Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] Lee D,Polisensky DH,Braam J Genome-wide identification of touch- and darkness-regulated Arabidopsis genes: a focus on calmodulin-like and XTH genes. New Phytol., 2005. 165(2): p. 429-44 [PMID:15720654] Suzuki N, et al. Enhanced tolerance to environmental stress in transgenic plants expressing the transcriptional coactivator multiprotein bridging factor 1c. Plant Physiol., 2005. 139(3): p. 1313-22 [PMID:16244138] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Ma S,Gong Q,Bohnert HJ Dissecting salt stress pathways. J. Exp. Bot., 2006. 57(5): p. 1097-107 [PMID:16510518] Zheng W, et al. Bestatin, an inhibitor of aminopeptidases, provides a chemical genetics approach to dissect jasmonate signaling in Arabidopsis. Plant Physiol., 2006. 141(4): p. 1400-13 [PMID:16798948] Shin R, et al. The Arabidopsis transcription factor MYB77 modulates auxin signal transduction. Plant Cell, 2007. 19(8): p. 2440-53 [PMID:17675404] Libault M,Wan J,Czechowski T,Udvardi M,Stacey G Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] Ferreira FJ,Guo C,Coleman JR Reduction of plastid-localized carbonic anhydrase activity results in reduced Arabidopsis seedling survivorship. Plant Physiol., 2008. 147(2): p. 585-94 [PMID:18434607] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Causier B,Ashworth M,Guo W,Davies B The TOPLESS interactome: a framework for gene repression in Arabidopsis. Plant Physiol., 2012. 158(1): p. 423-38 [PMID:22065421] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Lumba S, et al. A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis. Dev. Cell, 2014. 29(3): p. 360-72 [PMID:24823379] Zhao Y, et al. The ABA receptor PYL8 promotes lateral root growth by enhancing MYB77-dependent transcription of auxin-responsive genes. Sci Signal, 2014. 7(328): p. ra53 [PMID:24894996] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]