PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 678310291 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
|
||||||||
Family | ZF-HD | ||||||||
Protein Properties | Length: 88aa MW: 9636.8 Da PI: 8.1225 | ||||||||
Description | ZF-HD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | ZF-HD_dimer | 104 | 9.8e-33 | 24 | 78 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 +vrY eC+kNhAas+Gg+avDGC+Efmp g++gta+al CaAC CHRnFHRreve 678310291 24 SVRYAECQKNHAASIGGYAVDGCREFMPG-GADGTAEALSCAACTCHRNFHRREVE 78 79**************************9.999********************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04770 | 1.6E-30 | 25 | 77 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
TIGRFAMs | TIGR01566 | 1.7E-27 | 26 | 77 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
PROSITE profile | PS51523 | 25.503 | 27 | 76 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
ProDom | PD125774 | 4.0E-21 | 27 | 86 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 88 aa Download sequence Send to blast |
MNKKQIVIRR EGYMRSSSAG VSRSVRYAEC QKNHAASIGG YAVDGCREFM PGGADGTAEA 60 LSCAACTCHR NFHRREVELD VVCDNSYS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | 678310291 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028108012.1 | 9e-40 | mini zinc finger protein 2-like | ||||
Swissprot | Q9LJW5 | 5e-30 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
TrEMBL | S8EAP2 | 8e-40 | S8EAP2_9LAMI; Uncharacterized protein | ||||
STRING | XP_010037168.1 | 1e-36 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1105 | 24 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G74660.1 | 7e-30 | mini zinc finger 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|