PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G74660.1
Common NameF1M20.34, MIF1
Organism
Arabidopsis thaliana
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family ZF-HD
Protein Properties Length: 102aa    MW: 11212.5 Da    PI: 8.3798
Description mini zinc finger 1
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G74660.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.57.9e-343692360
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                 +vrY eC+kNhAa++Gg+avDGC+Efm++ g egt++al+CaACgCHRnFHR+ev++e
  AT1G74660.1 36 NVRYVECQKNHAANIGGYAVDGCREFMAA-GVEGTVDALRCAACGCHRNFHRKEVDTE 92
                 79**************************9.999*********************9876 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-392101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.0E-303689IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.5E-283889IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3623988IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009025anatomyvascular leaf
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020100anatomyhypocotyl
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MMKKRQMVIK QRSRNSNTSS SWTTTSSSSS SSEISNVRYV ECQKNHAANI GGYAVDGCRE  60
FMAAGVEGTV DALRCAACGC HRNFHRKEVD TEVVCEYSPP NA
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible260226_at1e-147
Expression AtlasAT1G74660-
AtGenExpressAT1G74660-
ATTED-IIAT1G74660-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mostly expressed in roots and stems, present in siliques and seedlings, and weakly observed in petioles, leaves and flowers. {ECO:0000269|PubMed:16412086}.
Functional Description ? help Back to Top
Source Description
TAIRConstitutive overexpression of MIF1 caused dramatic developmental defects, seedlings were non-responsive to gibberellin (GA) for cell elongation, hypersensitive to the GA synthesis inhibitor paclobutrazol (PAC) and abscisic acid (ABA), and hyposensitive to auxin, brassinosteroid and cytokinin, but normally responsive to ethylene.
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}.
Function -- GeneRIF ? help Back to Top
  1. MINI ZINC FINGER 1 (MIF1) is involved in mediating plant development through the regulation of multiple hormones. [MIF1]
    [PMID: 16412086]
  2. observations indicate that MIF1 regulates the ZHD5 activities in a dual step manner: nuclear import and DNA binding
    [PMID: 21059647]
  3. Data suggest that MIF1- or MIF3-overexpressing transgenic plants may provide a new genetic system for dissecting the molecular mechanism that maintains leaf determinate growth.
    [PMID: 21455630]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G74660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, auxin, brassinosteroid, cytokinin, gibberellin
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9CA51
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G74660
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0117651e-172AC011765.6 Arabidopsis thaliana chromosome 1 BAC F1M20 genomic sequence, complete sequence.
GenBankAY0853271e-172AY085327.1 Arabidopsis thaliana clone 14583 mRNA, complete sequence.
GenBankBT0248061e-172BT024806.1 Arabidopsis thaliana At1g74660 gene, complete cds.
GenBankCP0026841e-172CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_565088.12e-71mini zinc finger 1
SwissprotQ9CA511e-72MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A178WD694e-70A0A178WD69_ARATH; MIF1
STRINGAT1G74660.16e-71(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Representative plantOGRP9116237
Publications ? help Back to Top
  1. Hu W,Ma H
    Characterization of a novel putative zinc finger gene MIF1: involvement in multiple hormonal regulation of Arabidopsis development.
    Plant J., 2006. 45(3): p. 399-422
    [PMID:16412086]
  2. Tan QK,Irish VF
    The Arabidopsis zinc finger-homeodomain genes encode proteins with unique biochemical properties that are coordinately expressed during floral development.
    Plant Physiol., 2006. 140(3): p. 1095-108
    [PMID:16428600]
  3. Nemhauser JL,Hong F,Chory J
    Different plant hormones regulate similar processes through largely nonoverlapping transcriptional responses.
    Cell, 2006. 126(3): p. 467-75
    [PMID:16901781]
  4. Hu W,dePamphilis CW,Ma H
    Phylogenetic analysis of the plant-specific zinc finger-homeobox and mini zinc finger gene families.
    J Integr Plant Biol, 2008. 50(8): p. 1031-45
    [PMID:18713354]
  5. Hong SY,Kim OK,Kim SG,Yang MS,Park CM
    Nuclear import and DNA binding of the ZHD5 transcription factor is modulated by a competitive peptide inhibitor in Arabidopsis.
    J. Biol. Chem., 2011. 286(2): p. 1659-68
    [PMID:21059647]
  6. Brady SM, et al.
    A stele-enriched gene regulatory network in the Arabidopsis root.
    Mol. Syst. Biol., 2011. 7: p. 459
    [PMID:21245844]
  7. Hu W,Feng B,Ma H
    Ectopic expression of the Arabidopsis MINI ZINC FINGER1 and MIF3 genes induces shoot meristems on leaf margins.
    Plant Mol. Biol., 2011. 76(1-2): p. 57-68
    [PMID:21455630]