PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | TRIUR3_06488-P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 162aa MW: 17425.5 Da PI: 7.5014 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 131 | 4.8e-41 | 7 | 98 | 1 | 92 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll+++p +reda++sl+yeAear+rdPvyG+v+ i+ lq +++q++a TRIUR3_06488-P1 7 PCAACKLLRRKCTQGCVFAPYFPPDQPAKFANVHKVFGASNVSKLLNEIPVAQREDAVNSLAYEAEARLRDPVYGCVAYISVLQLKIKQAAA 98 7***************************************************************************************9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 24.425 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.2E-41 | 7 | 98 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009954 | Biological Process | proximal/distal pattern formation | ||||
GO:0009965 | Biological Process | leaf morphogenesis | ||||
GO:0048441 | Biological Process | petal development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MSSSNSPCAA CKLLRRKCTQ GCVFAPYFPP DQPAKFANVH KVFGASNVSK LLNEIPVAQR 60 EDAVNSLAYE AEARLRDPVY GCVAYISVLQ LKIKQAAAYD GTAPFLIQQQ ASPSALTYRM 120 EEPSPPPQSS GHSHVDMSHA PQQQRHQHTD GSDEGSGGAP TA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-47 | 3 | 95 | 7 | 99 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-47 | 3 | 95 | 7 | 99 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK368134 | 1e-144 | AK368134.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2068L23. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020161127.1 | 5e-63 | LOB domain-containing protein 6-like | ||||
Refseq | XP_020161128.1 | 5e-63 | LOB domain-containing protein 6-like | ||||
Swissprot | Q9FKZ3 | 4e-50 | LBD36_ARATH; LOB domain-containing protein 36 | ||||
TrEMBL | M7YYN8 | 1e-116 | M7YYN8_TRIUA; Uncharacterized protein | ||||
STRING | TRIUR3_06488-P1 | 1e-117 | (Triticum urartu) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6143 | 34 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66870.1 | 2e-52 | ASYMMETRIC LEAVES 2-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|