PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_04332-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 260aa    MW: 29017.7 Da    PI: 5.0499
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_04332-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM805.2e-252897171
              NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatg 71
                     lppGfrFhPtd+elvv+yL++kv+g++ ++  +i+evd+yk++PwdLp+++  +++ewyfF++rd+k++ g
  TRIUR3_04332-P1 28 LPPGFRFHPTDDELVVHYLCRKVAGQPQPV-PIIAEVDLYKFNPWDLPERALFGSREWYFFTPRDRKESGG 97
                     79*************************999.88***************8777899***********98754 PP

2NAM40.96.1e-139612896128
              NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +g++vg+kk Lvfy+grap+g+ktdW+mheyr+
  TRIUR3_04332-P1  96 GGRTVGIKKALVFYSGRAPRGVKTDWIMHEYRI 128
                      6789***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-4924154IPR003441NAC domain
PROSITE profilePS5100526.4228154IPR003441NAC domain
PfamPF023651.3E-2029128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MVKAEPTGAA AGAEGSSGRR DAEAELNLPP GFRFHPTDDE LVVHYLCRKV AGQPQPVPII  60
AEVDLYKFNP WDLPERALFG SREWYFFTPR DRKESGGRTV GIKKALVFYS GRAPRGVKTD  120
WIMHEYRIAE ADRAPGKKGS LKLDEWVLCR LYNKKNNWEK LKVEQDMAVE AGPNGEVMDA  180
LATDAMSDSF QTHDSSEIDS ASGLQQHGFM DMAQQQARMV TVKEDSDWFT GLSMDDLQTC  240
YMNMGQMVNP TTMPGQNGSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-75151602174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM0275760.0HM027576.1 Triticum aestivum NAC transcription factor 4 (NAC4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020181126.11e-173NAC domain-containing protein 68-like
SwissprotQ52QH41e-118NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLM7ZWY10.0M7ZWY1_TRIUA; NAC domain-containing protein 68
STRINGTRIUR3_04332-P10.0(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP53893761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.16e-65NAC family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Taga Y, et al.
    Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4.
    Plant Signal Behav, 2009. 4(8): p. 740-2
    [PMID:19820348]
  3. Xia N, et al.
    Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses.
    Mol. Biol. Rep., 2010. 37(8): p. 3703-12
    [PMID:20213512]
  4. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  5. Nakayama A, et al.
    Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice.
    BMC Plant Biol., 2013. 13: p. 150
    [PMID:24093634]
  6. Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS
    IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice.
    Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60
    [PMID:26766411]