PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA9644 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 158aa MW: 18482.7 Da PI: 10.88 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 38.8 | 2.1e-12 | 59 | 118 | 3 | 62 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 e+++ rr+++NRe+ArrsR RK+ +e+L++ v + aeN++L ++l+ + + +l++e Tp57577_TGAC_v2_mRNA9644 59 EDRKRRRMISNRESARRSRMRKQRHLENLRNQVNRFRAENQELNNTLQFIVYHFNRLRTE 118 57899**************************************99998766666666655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.6E-14 | 57 | 121 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.0E-10 | 59 | 119 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.829 | 59 | 122 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.2E-9 | 59 | 123 | No hit | No description |
SuperFamily | SSF57959 | 4.02E-11 | 61 | 110 | No hit | No description |
CDD | cd14702 | 5.94E-18 | 62 | 106 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 64 | 79 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MLSSLSNSDF TVLDEDVTPW NFPNIFSPFN PTSPKPTSSS GSGEPNEKPV LNDSNRNIED 60 RKRRRMISNR ESARRSRMRK QRHLENLRNQ VNRFRAENQE LNNTLQFIVY HFNRLRTENE 120 WLRLERTMLG QKLSNISQNL VFQPFSSAWP CNIVTAE* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 60 | 64 | RKRRR |
2 | 73 | 80 | RRSRMRKQ |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA9644 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004511808.2 | 4e-77 | bZIP transcription factor RISBZ3-like | ||||
TrEMBL | G7K2E8 | 1e-91 | G7K2E8_MEDTR; BZIP transcription factor | ||||
STRING | AES94499 | 2e-92 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5435 | 32 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49760.1 | 5e-23 | basic leucine-zipper 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA9644 |