PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA7211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family GeBP
Protein Properties Length: 435aa    MW: 48502.8 Da    PI: 4.5396
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA7211genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573121.93.1e-38106202197
                    DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehd 85 
                               klfqrlw++eDe+ lLqG++d+++++g+s ++d+ +fy+++k++++++++k+qlveKirrLKkK+++  +k++sgke++f+++hd
  Tp57577_TGAC_v2_mRNA7211 106 KLFQRLWTDEDEMELLQGFLDYTTQRGSSHHNDTAQFYDQIKSKLQLDFNKNQLVEKIRRLKKKYRNVLNKISSGKEFVFKTAHD 190
                               579********************************************************************************** PP

                    DUF573  86 qkifelskkiWg 97 
                               q +fe+s+kiW+
  Tp57577_TGAC_v2_mRNA7211 191 QATFEISRKIWN 202
                               ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.0E-34108202IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MASQQHDTVF PDEDIDDEDE EFHEYEEEDE EEEEDVLVEE EENASISAPS VTVAVPGSAI  60
SNGEIRPPIV TPTATTIVFA NSFPDSKRQR LDQIEEKKPP LEDSRKLFQR LWTDEDEMEL  120
LQGFLDYTTQ RGSSHHNDTA QFYDQIKSKL QLDFNKNQLV EKIRRLKKKY RNVLNKISSG  180
KEFVFKTAHD QATFEISRKI WNNVAPIAGD IAIDDEEINL NPSPNPNLNF TPVILKSEST  240
SHTRKRSRPR SVIRSFEKRE SNDAIASIRD RDYLNINLNN PNPNFNPNPI ANPIIATTSA  300
TVNTAATTTA PTITTAPNTN PAINANNYSN NCSSNIGNSV AGVIEETVRS CLSPLLKELM  360
TSATGGPFGG ARGGSGFAMN PLQLMNLGFG EVVDEKWRKQ QILELEVYSK RLELVQDQIK  420
ASIDELRSVG GSTF*
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA7211
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1714980.0AC171498.6 Medicago truncatula chromosome 7 BAC clone mth2-7n16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003626394.10.0probable transcription factor At5g28040
TrEMBLA0A2K3LQD10.0A0A2K3LQD1_TRIPR; DNA-binding storekeeper transcriptional regulator (Fragment)
STRINGAES826120.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32553365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.26e-58DNA-binding storekeeper protein-related transcriptional regulator