PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA31104 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 115aa MW: 13538 Da PI: 10.7219 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.1 | 6.4e-16 | 23 | 70 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +l+ +v ++G +W+ ++ g+ R++k+c++rw +yl Tp57577_TGAC_v2_mRNA31104 23 KGTWTAEEDRKLIAYVSRYGCWNWRQLPKFAGLARCGKSCRLRWMNYL 70 799*****************99************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-23 | 15 | 73 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 22.028 | 18 | 74 | IPR017930 | Myb domain |
SMART | SM00717 | 5.4E-10 | 22 | 72 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-14 | 23 | 70 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.82E-24 | 24 | 101 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.13E-9 | 25 | 70 | No hit | No description |
PROSITE profile | PS50090 | 4.449 | 71 | 101 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 6.6E-10 | 74 | 101 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
LLISQKLVKM ARTPSCDKSG MRKGTWTAEE DRKLIAYVSR YGCWNWRQLP KFAGLARCGK 60 SCRLRWMNYL RPNIKRGNFT QQEEDLIITM HKKLGNRYII IYPTLLFSIN YKFV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 7e-18 | 21 | 105 | 25 | 108 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as negative regulator of cold tolerance. Negatively regulates beta-amylase genes at the transcriptional level in response to cold stress. Suppresses beta-amylase gene expression by interacting with TIFY11A/JAZ9. Maltose produced by beta-amylases has a role in protecting cell membranes under cold stress conditions in rice and may contribute to the cold tolerance as a compatible solute. {ECO:0000269|PubMed:28062835}. | |||||
UniProt | Plays a regulatory role in meristem function. Functions as component of a regulatory network controlling the establishment and/or development of the shoot system by the regulation of apical meristem function (PubMed:9681014). May play a role in tolerance to boric acid (PubMed:16861809). {ECO:0000269|PubMed:16861809, ECO:0000269|PubMed:9681014}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA31104 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), drought, light and wounding in leaves. Down-regulated by drought and ABA in roots. {ECO:0000269|PubMed:9681014}. | |||||
UniProt | INDUCTION: Induced by cold stress and flooding. {ECO:0000269|PubMed:28062835}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT138850 | 3e-81 | BT138850.1 Medicago truncatula clone JCVI-FLMt-15C13 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004513558.1 | 9e-59 | transcription factor MYB30-like | ||||
Swissprot | Q6K1S6 | 7e-40 | MYB30_ORYSJ; Transcription factor MYB30 | ||||
Swissprot | Q9LNC9 | 4e-40 | MYB13_ARATH; Transcription factor MYB13 | ||||
TrEMBL | A0A2Z6PCB6 | 3e-60 | A0A2Z6PCB6_TRISU; Uncharacterized protein | ||||
STRING | XP_004513558.1 | 3e-58 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF356 | 33 | 186 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06180.1 | 2e-42 | myb domain protein 13 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA31104 |
Publications ? help Back to Top | |||
---|---|---|---|
|