PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G06180.1

Common Name

ATMYB13, ATMYBLFGN, F9P14.4, MYB13

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 246aa MW: 27951.2 Da PI: 6.1755

Description

myb domain protein 13

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G06180.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54	3.8e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W++eEd +l++++ ++G ++W++ ++ g+ R++k+c++rw +yl AT1G06180.1 14 KGPWSAEEDRILINYISLHGHPNWRALPKLAGLLRCGKSCRLRWINYL 61 79****************************99**********97 PP
2	Myb_DNA-binding	50.5	4.9e-16	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E++ ++ ++++lG++ W++Ia++++ gRt++++k+ w+++l AT1G06180.1 67 RGNFTPHEEDTIISLHQLLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112 89******************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.0E-24	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.639	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	8.63E-30	11	108	IPR009057	Homeodomain-like
SMART	SM00717	7.7E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	4.7E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	2.60E-10	16	61	No hit	No description
PROSITE profile	PS51294	23.5	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.8E-26	65	116	IPR009057	Homeodomain-like
SMART	SM00717	1.4E-13	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-14	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	4.85E-9	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009651	Biological Process	response to salt stress
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0030154	Biological Process	cell differentiation
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 246 aa Download sequence Send to blast
MGRRPCCEKI GLKKGPWSAE EDRILINYIS LHGHPNWRAL PKLAGLLRCG KSCRLRWINY 60 LRPDIKRGNF TPHEEDTIIS LHQLLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLHHSQ 120 DQNNKEDFVS TTAAEMPTSP QQQSSSSADI SAITTLGNNN DISNSNKDSA TSSEDVLAII 180 DESFWSEVVL MDCDISGNEK NEKKIENWEG SLDRNDKGYN HDMEFWFDHL TSSSCIIGEM 240 SDISEF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-25	12	116	5	108	B-MYB
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	18390621	0.0
Genevisible	260784_at	0.0
Expression Atlas	AT1G06180	-
AtGenExpress	AT1G06180	-
ATTED-II	AT1G06180	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots and flowers. Expressed in shoot apex, axillary buds, at the basis of flowers and branching points of inflorescences. {ECO:0000269\|PubMed:9681014}.

Functional Description ? help Back to Top
Source	Description
TAIR	member of MYB3R- and R2R3- type MYB- encoding genes
UniProt	Plays a regulatory role in meristem function. Functions as component of a regulatory network controlling the establishment and/or development of the shoot system by the regulation of apical meristem function (PubMed:9681014). May play a role in tolerance to boric acid (PubMed:16861809). {ECO:0000269\|PubMed:16861809, ECO:0000269\|PubMed:9681014}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00127	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G06180.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by abscisic acid (ABA), drought, light and wounding in leaves. Down-regulated by drought and ABA in roots. {ECO:0000269\|PubMed:9681014}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G21970 (R), AT3G26790 (R)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, ethylene, gibberellin, jasmonic acid, salicylic acid

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G06180

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY519550	0.0	AY519550.1 Arabidopsis thaliana MYB transcription factor (At1g06180) mRNA, complete cds.
GenBank	BT025173	0.0	BT025173.1 Arabidopsis thaliana At1g06180 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_172108.1	0.0	myb domain protein 13
Swissprot	Q9LNC9	0.0	MYB13_ARATH; Transcription factor MYB13
TrEMBL	A0A178W702	0.0	A0A178W702_ARATH; MYB13
STRING	AT1G06180.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT1G06180.1
Entrez Gene	837127
iHOP	AT1G06180
wikigenes	AT1G06180

Publications ? help Back to Top
Vicient CM,Bies-Etheve N,Delseny M Changes in gene expression in the leafy cotyledon1 (lec1) and fusca3 (fus3) mutants of Arabidopsis thaliana L. J. Exp. Bot., 2000. 51(347): p. 995-1003 [PMID:10948227] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Steffens NO,Galuschka C,Schindler M,B AthaMap: an online resource for in silico transcription factor binding sites in the Arabidopsis thaliana genome. Nucleic Acids Res., 2004. 32(Database issue): p. D368-72 [PMID:14681436] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Oravecz A, et al. CONSTITUTIVELY PHOTOMORPHOGENIC1 is required for the UV-B response in Arabidopsis. Plant Cell, 2006. 18(8): p. 1975-90 [PMID:16829591] Nozawa A,Miwa K,Kobayashi M,Fujiwara T Isolation of Arabidopsis thaliana cDNAs that confer yeast boric acid tolerance. Biosci. Biotechnol. Biochem., 2006. 70(7): p. 1724-30 [PMID:16861809] Cao D,Cheng H,Wu W,Soo HM,Peng J Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] AbuQamar S, et al. Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection. Plant J., 2006. 48(1): p. 28-44 [PMID:16925600] Xin Z,Mandaokar A,Chen J,Last RL,Browse J Arabidopsis ESK1 encodes a novel regulator of freezing tolerance. Plant J., 2007. 49(5): p. 786-99 [PMID:17316173] Bedon F,Grima-Pettenati J,Mackay J Conifer R2R3-MYB transcription factors: sequence analyses and gene expression in wood-forming tissues of white spruce (Picea glauca). BMC Plant Biol., 2007. 7: p. 17 [PMID:17397551] Kleine T,Kindgren P,Benedict C,Hendrickson L,Strand A Genome-wide gene expression analysis reveals a critical role for CRYPTOCHROME1 in the response of Arabidopsis to high irradiance. Plant Physiol., 2007. 144(3): p. 1391-406 [PMID:17478635] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Huang BH, et al. Positive selection and functional divergence of R2R3-MYB paralogous genes expressed in inflorescence buds of Scutellaria species (Labiatae). Int J Mol Sci, 2015. 16(3): p. 5900-21 [PMID:25782156] Kirik V,K Ectopic expression of a novel MYB gene modifies the architecture of the Arabidopsis inflorescence. Plant J., 1998. 13(6): p. 729-42 [PMID:9681014] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]