PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp57577_TGAC_v2_mRNA25800 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 186aa MW: 21623.1 Da PI: 11.3622 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43.4 | 8.1e-14 | 29 | 74 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g+W teEd+ l++ vk++G+++W++I ++ + Rt+k+c++rw + Tp57577_TGAC_v2_mRNA25800 29 KGPWKTEEDDVLLNHVKKYGPRDWSSIRSKGLLQRTGKSCRLRWVN 74 79*************************8887799**********87 PP | |||||||
2 | Myb_DNA-binding | 48.5 | 2.1e-15 | 85 | 124 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++Tt+E+ +++ +q+G++ W++Ia++++ gRt++++k++w Tp57577_TGAC_v2_mRNA25800 85 KFTTDEERTVIELQEQFGNK-WAKIASHLP-GRTDNDVKNFW 124 79******************.*********.*********** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-21 | 23 | 77 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.599 | 24 | 80 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.69E-28 | 27 | 124 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.3E-10 | 28 | 78 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.73E-9 | 31 | 76 | No hit | No description |
Pfam | PF13921 | 6.4E-12 | 32 | 82 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.4E-19 | 78 | 130 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 18.098 | 81 | 132 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-13 | 82 | 130 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.4E-13 | 85 | 124 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.98E-10 | 85 | 124 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0048235 | Biological Process | pollen sperm cell differentiation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
LCVVLLIIGR NRIRRRKMHG KKEQEHVRKG PWKTEEDDVL LNHVKKYGPR DWSSIRSKGL 60 LQRTGKSCRL RWVNKLRPNL KNGCKFTTDE ERTVIELQEQ FGNKWAKIAS HLPGRTDNDV 120 KNFWSSRQKR LARLLKISSS SSTSKSHKNK NKAKVSLSVP TSEVITVCFL QFFRGKINFF 180 SNFEK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 5e-28 | 29 | 130 | 27 | 126 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression (PubMed:15694308, PubMed:15618418, PubMed:19300502, PubMed:21285328). Binds to canonical MYB sites 5'-AACCGTC-3', 5'-AAACCGC-3' and 5'-AACCGT-3' in promoters to trigger the expression of male germline-specific or enriched genes (e.g. MGH3, GEX2 and GCS1), including those required for fertilization (PubMed:21285328, PubMed:19300502). Required for sperm cell specification leading to pollen maturation by activating a germline-specific regulon (PubMed:21285328, PubMed:15694308, PubMed:15618418, PubMed:19300502). Involved in pollen mitosis entry at G2-M transition via the regulation of CYCB1-1, DAZ1 and DAZ2 expression (PubMed:15618418, PubMed:19300502, PubMed:24876252). {ECO:0000269|PubMed:15618418, ECO:0000269|PubMed:15694308, ECO:0000269|PubMed:19300502, ECO:0000269|PubMed:21285328, ECO:0000269|PubMed:24876252}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp57577_TGAC_v2_mRNA25800 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the microRNA 159 (miR159); the production of miR159 is stimulated by the anaphase promoting complex/cyclosome (APC/C) (PubMed:21441434). Activated by ARID1 in male germline cells via specific histone acetylation regulation (e.g. H3K9Ac) (PubMed:25057814). {ECO:0000269|PubMed:21441434, ECO:0000269|PubMed:25057814}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027337947.1 | 1e-81 | transcription factor DUO1 | ||||
Swissprot | A0A178VEK7 | 2e-71 | DUO1_ARATH; Transcription factor DUO1 | ||||
TrEMBL | A0A2K3L3G6 | 1e-101 | A0A2K3L3G6_TRIPR; MYB-related protein 305-like protein | ||||
STRING | AET01209 | 2e-80 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3693 | 31 | 64 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G60460.1 | 8e-72 | MYB family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Tp57577_TGAC_v2_mRNA25800 |
Publications ? help Back to Top | |||
---|---|---|---|
|