PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G60460.1

Common Name

DUO1, MYB125, T8B10_120

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 297aa MW: 33649.6 Da PI: 6.0755

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G60460.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.8	1.2e-13	10	55	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g+W +eEde l++ vk++G+++W++I ++ + Rt+k+c++rw + AT3G60460.1 10 KGPWKAEEDEVLINHVKRYGPRDWSSIRSKGLLQRTGKSCRLRWVN 55 79***********************8887799********87 PP
2	Myb_DNA-binding	40.4	6.9e-13	66	105	3	44
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +++++E+ +++ ++G++ W++Ia +++ gRt++++k++w AT3G60460.1 66 KFSADEERTVIELQSEFGNK-WARIATYLP-GRTDNDVKNFW 105 79****************.*****.********* PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.8E-22	4	58	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.325	5	61	IPR017930	Myb domain
SuperFamily	SSF46689	7.42E-28	8	105	IPR009057	Homeodomain-like
SMART	SM00717	7.1E-11	9	59	IPR001005	SANT/Myb domain
CDD	cd00167	5.77E-11	12	57	No hit	No description
Pfam	PF13921	7.5E-12	13	63	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.3E-17	59	111	IPR009057	Homeodomain-like
PROSITE profile	PS51294	17.57	62	113	IPR017930	Myb domain
SMART	SM00717	6.7E-12	63	111	IPR001005	SANT/Myb domain
Pfam	PF00249	6.7E-12	66	105	IPR001005	SANT/Myb domain
CDD	cd00167	8.37E-10	66	105	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0048235	Biological Process	pollen sperm cell differentiation
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000084	anatomy	plant sperm cell
PO:0020097	anatomy	generative cell

Sequence ? help Back to Top
Protein Sequence Length: 297 aa Download sequence Send to blast
MEAKKEEIKK GPWKAEEDEV LINHVKRYGP RDWSSIRSKG LLQRTGKSCR LRWVNKLRPN 60 LKNGCKFSAD EERTVIELQS EFGNKWARIA TYLPGRTDND VKNFWSSRQK RLARILHNSS 120 DASSSSFNPK SSSSHRLKGK NVKPIRQSSQ GFGLVEEEVT VSSSCSQMVP YSSDQVGDEV 180 LRLPDLGVKL EHQPFAFGTD LVLAEYSDSQ NDANQQAISP FSPESRELLA RLDDPFYYDI 240 LGPADSSEPL FALPQPFFEP SPVPRRCRHV SKDEEADVFL DDFPADMFDQ VDPIPSP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-27	7	111	24	126	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT3G60460
AtGenExpress	AT3G60460

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Strict spatial and temporal transcriptional activation leading to a specific expression in the male germline cells; this specific expression pattern is dependent of the regulatory region of DUO1 (ROD1) 5'-YAACYGY-3' in its promoter (PubMed:15694308, PubMed:27624837). First observed in the germ cell during or soon after engulfment by the vegetative cell, just after asymmetric division. In maturating pollen, accumulates in germ cells before mitosis and remains high in mature sperm cells. Expression persists during pollen development (PubMed:19300502). {ECO:0000269\|PubMed:15694308, ECO:0000269\|PubMed:19300502, ECO:0000269\|PubMed:27624837}.
Uniprot	TISSUE SPECIFICITY: Confined to inflorescences, especially in stamens and pollen. {ECO:0000269\|PubMed:15694308}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes an R2R3 myb transcription factor that is required for male gamete formation, specifically for entry of the generative cell into mitosis. Specifically expressed in the male germline.
UniProt	Transcription activator that acts as a positive regulator of male germline development by promoting both gametic cell specification and cell cycle progression (PubMed:15694308, PubMed:15618418, PubMed:19300502, PubMed:21285328). Binds to canonical MYB sites 5'-AACCGTC-3', 5'-AAACCGC-3' and 5'-AACCGT-3' in promoters to trigger the expression of male germline-specific or enriched genes (e.g. MGH3, GEX2 and GCS1), including those required for fertilization (PubMed:21285328, PubMed:19300502). Required for sperm cell specification leading to pollen maturation by activating a germline-specific regulon (PubMed:21285328, PubMed:15694308, PubMed:15618418, PubMed:19300502). Involved in pollen mitosis entry at G2-M transition via the regulation of CYCB1-1, DAZ1 and DAZ2 expression (PubMed:15618418, PubMed:19300502, PubMed:24876252). {ECO:0000269\|PubMed:15618418, ECO:0000269\|PubMed:15694308, ECO:0000269\|PubMed:19300502, ECO:0000269\|PubMed:21285328, ECO:0000269\|PubMed:24876252}.

Function -- GeneRIF ? help Back to Top
DUO1 controls male gamete formation in plants. [DUO1] [PMID: 15694308] The DUO1 regulon has a major role in shaping the germline transcriptome and functions to commit progenitor germ cells to sperm cell differentiation. [PMID: 21285328] key promoter sequences required for the germline-specific regulation of DUO1 transcription, are identified. [PMID: 27624837]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G60460.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by the microRNA 159 (miR159); the production of miR159 is stimulated by the anaphase promoting complex/cyclosome (APC/C) (PubMed:21441434). Activated by ARID1 in male germline cells via specific histone acetylation regulation (e.g. H3K9Ac) (PubMed:25057814). {ECO:0000269\|PubMed:21441434, ECO:0000269\|PubMed:25057814}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G60460

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF469468	0.0	AF469468.1 Arabidopsis thaliana putative transcription factor (MYB125) mRNA, complete cds.
GenBank	HM776521	0.0	HM776521.1 Arabidopsis thaliana duo pollen 1 (DUO1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_191605.2	0.0	myb-like HTH transcriptional regulator family protein
Swissprot	A0A178VEK7	0.0	DUO1_ARATH; Transcription factor DUO1
TrEMBL	F4JBU2	0.0	F4JBU2_ARATH; DUO1
STRING	AT3G60460.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6551	28	42
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT3G60460.1
Entrez Gene	825217
iHOP	AT3G60460
wikigenes	AT3G60460

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jiang C,Gu X,Peterson T Identification of conserved gene structures and carboxy-terminal motifs in the Myb gene family of Arabidopsis and Oryza sativa L. ssp. indica. Genome Biol., 2004. 5(7): p. R46 [PMID:15239831] Durbarry A,Vizir I,Twell D Male germ line development in Arabidopsis. duo pollen mutants reveal gametophytic regulators of generative cell cycle progression. Plant Physiol., 2005. 137(1): p. 297-307 [PMID:15618418] Rotman N, et al. A novel class of MYB factors controls sperm-cell formation in plants. Curr. Biol., 2005. 15(3): p. 244-8 [PMID:15694308] Mehrtens F,Kranz H,Bednarek P,Weisshaar B The Arabidopsis transcription factor MYB12 is a flavonol-specific regulator of phenylpropanoid biosynthesis. Plant Physiol., 2005. 138(2): p. 1083-96 [PMID:15923334] Okada T,Bhalla PL,Singh MB Expressed sequence tag analysis of Lilium longiflorum generative cells. Plant Cell Physiol., 2006. 47(6): p. 698-705 [PMID:16571618] Brownfield L, et al. A plant germline-specific integrator of sperm specification and cell cycle progression. PLoS Genet., 2009. 5(3): p. e1000430 [PMID:19300502] Brownfield L, et al. Arabidopsis DUO POLLEN3 is a key regulator of male germline development and embryogenesis. Plant Cell, 2009. 21(7): p. 1940-56 [PMID:19638475] Cominelli E,Tonelli C A new role for plant R2R3-MYB transcription factors in cell cycle regulation. Cell Res., 2009. 19(11): p. 1231-2 [PMID:19881525] Borg M, et al. The R2R3 MYB transcription factor DUO1 activates a male germline-specific regulon essential for sperm cell differentiation in Arabidopsis. Plant Cell, 2011. 23(2): p. 534-49 [PMID:21285328] Zheng B,Chen X,McCormick S The anaphase-promoting complex is a dual integrator that regulates both MicroRNA-mediated transcriptional regulation of cyclin B1 and degradation of Cyclin B1 during Arabidopsis male gametophyte development. Plant Cell, 2011. 23(3): p. 1033-46 [PMID:21441434] Beale KM,Leydon AR,Johnson MA Gamete fusion is required to block multiple pollen tubes from entering an Arabidopsis ovule. Curr. Biol., 2012. 22(12): p. 1090-4 [PMID:22608506] Zheng B,He H,Zheng Y,Wu W,McCormick S An ARID domain-containing protein within nuclear bodies is required for sperm cell formation in Arabidopsis thaliana. PLoS Genet., 2014. 10(7): p. e1004421 [PMID:25057814] Peters B, et al. A Conserved cis-Regulatory Module Determines Germline Fate through Activation of the Transcription Factor DUO1 Promoter. Plant Physiol., 2017. 173(1): p. 280-293 [PMID:27624837] Zheng Z, et al. Target RNA Secondary Structure Is a Major Determinant of miR159 Efficacy. Plant Physiol., 2017. 174(3): p. 1764-1778 [PMID:28515145]