PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp_un0577_001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 97aa MW: 11077.7 Da PI: 4.2959 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 53.5 | 8.2e-17 | 20 | 66 | 2 | 49 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 pGf+F+Ptd el+++yLk+k++g + ++ e+i+evdiy++ePwdLp Tp_un0577_001 20 FPGFKFSPTDIELISYYLKRKMDGLERSV-EIIPEVDIYNFEPWDLPG 66 59************************999.89**************93 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.62E-18 | 9 | 68 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 16.842 | 19 | 97 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.4E-7 | 21 | 62 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 97 aa Download sequence Send to blast |
MDAAEVSRDT SLSMAVSTAF PGFKFSPTDI ELISYYLKRK MDGLERSVEI IPEVDIYNFE 60 PWDLPGSSPY LNFKPFSSSR FLKIILSFLC FEVGFET |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in plant cell division. {ECO:0000269|PubMed:16803883}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF974763 | 6e-60 | KF974763.1 Brassica napus NAC transcription factor 60-1 (NAC60-1.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013639422.1 | 2e-34 | PREDICTED: NAC domain-containing protein 60 isoform X1 | ||||
Refseq | XP_013639424.1 | 2e-34 | PREDICTED: NAC domain-containing protein 60 isoform X2 | ||||
Refseq | XP_013671957.1 | 2e-34 | NAC domain-containing protein 60 isoform X1 | ||||
Swissprot | Q94F58 | 2e-30 | NAC89_ARATH; NAC domain-containing protein 89 | ||||
TrEMBL | A0A078G4K1 | 4e-33 | A0A078G4K1_BRANA; BnaC01g23890D protein | ||||
TrEMBL | A0A0D3A8I0 | 4e-33 | A0A0D3A8I0_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6FDY0 | 4e-33 | A0A3P6FDY0_BRAOL; Uncharacterized protein | ||||
STRING | Bo1g063720.1 | 7e-34 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7967 | 13 | 40 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G22290.1 | 8e-33 | NAC domain containing protein 89 |
Publications ? help Back to Top | |||
---|---|---|---|
|