PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G22290.1 | ||||||||
Common Name | anac089, FAN, FSQ6, MWD9.7, NAC089, T6G21.9 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 340aa MW: 38046.1 Da PI: 5.2049 | ||||||||
Description | NAC domain containing protein 89 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 156.7 | 9.5e-49 | 22 | 147 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 pGf+F+Ptd el+++yLk+k++g + ++ evi++++iy++ePwdLp k++ ++++ew+fF+ r kky++g++++ratk gyWkatgk+++v+s ++e AT5G22290.1 22 FPGFKFSPTDVELISYYLKRKMDGLERSV-EVIPDLEIYNFEPWDLPdKSIVKSDSEWFFFCARGKKYPHGSQNRRATKMGYWKATGKERDVKS-GSE 117 69************************999.99***************778888899**************************************.9** PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 ++g+k+tLvf+ grapkge+tdW+mhey + AT5G22290.1 118 VIGTKRTLVFHIGRAPKGERTDWIMHEYCV 147 ****************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.48E-54 | 11 | 163 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.681 | 21 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.5E-25 | 23 | 146 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009626 | Biological Process | plant-type hypersensitive response | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0034976 | Biological Process | response to endoplasmic reticulum stress | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005783 | Cellular Component | endoplasmic reticulum | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0005515 | Molecular Function | protein binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 340 aa Download sequence Send to blast |
MDTKAVGVSK DTAASMEAST VFPGFKFSPT DVELISYYLK RKMDGLERSV EVIPDLEIYN 60 FEPWDLPDKS IVKSDSEWFF FCARGKKYPH GSQNRRATKM GYWKATGKER DVKSGSEVIG 120 TKRTLVFHIG RAPKGERTDW IMHEYCVKGV SLDDAMVVCR VRRNKEYNSG TSQKAPKPNS 180 SAEKHAKVQN GATSSGSPSD WDNLVDFYLA GESGEKLLAE MAESSENLQV DNDEDFFADI 240 LRDEIINLDE AVMTGNTPNE VPTLESASME IRVLPLPNMI DKQMSSLLEE RPSQKKKGKD 300 ATESLSSCFV GLYSIKSVNK ARWDVIIGVV ALIAMLFYLE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-40 | 23 | 165 | 19 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-40 | 23 | 165 | 19 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-40 | 23 | 165 | 19 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-40 | 23 | 165 | 19 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-40 | 23 | 165 | 22 | 169 | NAC domain-containing protein 19 |
3swm_B | 2e-40 | 23 | 165 | 22 | 169 | NAC domain-containing protein 19 |
3swm_C | 2e-40 | 23 | 165 | 22 | 169 | NAC domain-containing protein 19 |
3swm_D | 2e-40 | 23 | 165 | 22 | 169 | NAC domain-containing protein 19 |
3swp_A | 2e-40 | 23 | 165 | 22 | 169 | NAC domain-containing protein 19 |
3swp_B | 2e-40 | 23 | 165 | 22 | 169 | NAC domain-containing protein 19 |
3swp_C | 2e-40 | 23 | 165 | 22 | 169 | NAC domain-containing protein 19 |
3swp_D | 2e-40 | 23 | 165 | 22 | 169 | NAC domain-containing protein 19 |
4dul_A | 2e-40 | 23 | 165 | 19 | 166 | NAC domain-containing protein 19 |
4dul_B | 2e-40 | 23 | 165 | 19 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.7356 | 0.0 | bud| flower| leaf |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145358296 | 0.0 | ||||
Genevisible | 249944_at | 0.0 | ||||
Expression Atlas | AT5G22290 | - | ||||
AtGenExpress | AT5G22290 | - | ||||
ATTED-II | AT5G22290 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in plant cell division. {ECO:0000269|PubMed:16803883}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G22290.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
IntAct | Search Q94F58 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G22290 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF385685 | 0.0 | AF385685.1 Arabidopsis thaliana AT5g22290/MWD9_7 mRNA, complete cds. | |||
GenBank | AY078006 | 0.0 | AY078006.1 Arabidopsis thaliana AT5g22290/MWD9_7 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_568414.1 | 0.0 | NAC domain containing protein 89 | ||||
Swissprot | Q94F58 | 0.0 | NAC89_ARATH; NAC domain-containing protein 89 | ||||
TrEMBL | A0A178UI96 | 0.0 | A0A178UI96_ARATH; NAC089 | ||||
STRING | AT5G22290.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4309 | 23 | 56 | Representative plant | OGRP10249 | 6 | 10 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G22290.1 |
Entrez Gene | 832289 |
iHOP | AT5G22290 |
wikigenes | AT5G22290 |