PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp7g00470 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 178aa MW: 20715.3 Da PI: 7.9916 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.9 | 7.8e-32 | 96 | 154 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+d +vv++tYeg Hnh+ Tp7g00470 96 LDDGYRWRKYGQKSVKNNGHPRSYYRCTYHTCNVKKQVQRLAKDSNVVVTTYEGIHNHP 154 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 7.6E-32 | 83 | 154 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 4.18E-28 | 88 | 155 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.759 | 91 | 156 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.8E-36 | 96 | 155 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-25 | 97 | 154 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MERQDIDHML SLDVENNDVN TFSSFVDKTL MMMPPLTYSG EVEPSSSSWC PTSFHVPTQP 60 LENDQIGDEG KKKEKEKRSR KVPRIAFHTR SDDDVLDDGY RWRKYGQKSV KNNGHPRSYY 120 RCTYHTCNVK KQVQRLAKDS NVVVTTYEGI HNHPCEKLME TLNPLLRQLQ FLSSFSNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 8e-25 | 86 | 153 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 8e-25 | 86 | 153 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00539 | DAP | Transfer from AT5G41570 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp7g00470 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF430042 | 0.0 | KF430042.1 Brassica rapa WRKY transcription factor 24 (WRKY24) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013635201.1 | 1e-111 | PREDICTED: probable WRKY transcription factor 24 | ||||
Refseq | XP_013743457.1 | 1e-111 | probable WRKY transcription factor 24 | ||||
Refseq | XP_013746877.1 | 1e-111 | probable WRKY transcription factor 24 | ||||
Swissprot | Q9FFS3 | 1e-103 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | V5RH05 | 1e-112 | V5RH05_BRACM; WRKY transcription factor 24 | ||||
STRING | Bo4g142200.1 | 1e-110 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 4e-88 | WRKY DNA-binding protein 24 |