PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp4g04910 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 134aa MW: 15542.3 Da PI: 10.271 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 49.1 | 1.2e-15 | 63 | 122 | 1 | 60 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 e+e++r +r+ +NR++A+ R+RKka++ eLe++vk Le++N++L ++l++l+ke l+ Tp4g04910 63 ERERRRLKRLLRNRVSAQQARERKKAYVSELEKRVKGLETKNTELDERLSTLQKENHMLR 122 799***************************************************998776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00041 | 7.3E-6 | 62 | 78 | IPR001630 | cAMP response element binding (CREB) protein |
SMART | SM00338 | 6.7E-13 | 63 | 127 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 8.2E-16 | 63 | 124 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 12.403 | 65 | 128 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.52E-13 | 67 | 125 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.2E-17 | 67 | 125 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 70 | 85 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14704 | 4.36E-12 | 77 | 119 | No hit | No description |
PRINTS | PR00041 | 7.3E-6 | 80 | 100 | IPR001630 | cAMP response element binding (CREB) protein |
PRINTS | PR00041 | 7.3E-6 | 100 | 117 | IPR001630 | cAMP response element binding (CREB) protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 134 aa Download sequence Send to blast |
MSQMGFSNSL SQENFRENPQ DSDNEIGETH NLYDDAGEQS LARSEDVKLS GKVQRIKGKD 60 PAERERRRLK RLLRNRVSAQ QARERKKAYV SELEKRVKGL ETKNTELDER LSTLQKENHM 120 LRHIIKNTTS TSNS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2oqq_A | 6e-14 | 88 | 127 | 3 | 42 | Transcription factor HY5 |
2oqq_B | 6e-14 | 88 | 127 | 3 | 42 | Transcription factor HY5 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 64 | 71 | ERRRLKRL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp4g04910 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018439034.1 | 3e-48 | PREDICTED: transcription factor HY5-like | ||||
Swissprot | Q9SM50 | 2e-35 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | A0A1J3IVF6 | 9e-39 | A0A1J3IVF6_NOCCA; Transcription factor HY5 | ||||
STRING | XP_010525968.1 | 4e-44 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5691 | 27 | 49 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11260.1 | 3e-28 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|