PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp4g00580 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 156aa MW: 17685.2 Da PI: 9.6282 | ||||||||
Description | SRS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 94.1 | 2.8e-29 | 6 | 65 | 5 | 64 |
DUF702 5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaa 64 + +C+dCGnqakk+C+++RCRtCCks++f+C+th+kstWvpa++r++++q +++ + ++ Tp4g00580 6 GRRCEDCGNQAKKECVYMRCRTCCKSKAFHCQTHIKSTWVPAYRRSHKHQSQTQHQPLST 65 569*******************************************99776665544433 PP | |||||||
2 | DUF702 | 83.7 | 4.6e-26 | 65 | 123 | 96 | 154 |
DUF702 96 skkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 +++ ++++P+e+ss a frcv+vss+ddg+e++aYqt+v+igGhvf+GiL+dqGl++ Tp4g00580 65 TTNAKRVRHFPAELSSLADFRCVKVSSLDDGKEQYAYQTTVNIGGHVFRGILHDQGLDK 123 334456778***********************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 2.2E-25 | 6 | 63 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 1.5E-28 | 9 | 50 | IPR006510 | Zinc finger, lateral root primordium type 1 |
Pfam | PF05142 | 9.1E-23 | 66 | 122 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01624 | 2.0E-29 | 73 | 121 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MMMIMGRRCE DCGNQAKKEC VYMRCRTCCK SKAFHCQTHI KSTWVPAYRR SHKHQSQTQH 60 QPLSTTNAKR VRHFPAELSS LADFRCVKVS SLDDGKEQYA YQTTVNIGGH VFRGILHDQG 120 LDKLLHTSSS SCPLTIASSF TNFMSGTQFP SHQKAL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp4g00580 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC006841 | 6e-55 | AC006841.7 Arabidopsis thaliana chromosome 2 clone F3K23 map mi148, complete sequence. | |||
GenBank | CP002685 | 6e-55 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018438354.1 | 8e-83 | PREDICTED: protein SHI RELATED SEQUENCE 3 | ||||
Swissprot | Q9SJT8 | 8e-83 | SRS3_ARATH; Protein SHI RELATED SEQUENCE 3 | ||||
TrEMBL | D7LBD1 | 1e-82 | D7LBD1_ARALL; Uncharacterized protein | ||||
STRING | Bostr.5022s0092.1.p | 3e-85 | (Boechera stricta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9188 | 26 | 38 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G21400.1 | 3e-85 | SHI-related sequence3 |