PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G21400.1 | ||||||||
Common Name | F3K23.16, SRS3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | SRS | ||||||||
Protein Properties | Length: 174aa MW: 19813.7 Da PI: 9.5586 | ||||||||
Description | SHI-related sequence3 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF702 | 94.5 | 2.2e-29 | 6 | 60 | 5 | 59 |
DUF702 5 tasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaa 59 + +C+dCGnqakkdC+++RCRtCCks++f+C+th+kstWvpa++r+++++q + + AT2G21400.1 6 GRKCEDCGNQAKKDCVYMRCRTCCKSKAFHCQTHIKSTWVPAYRRSHHKHQSQPL 60 569********************************************98887765 PP | |||||||
2 | DUF702 | 87.4 | 3.3e-27 | 54 | 126 | 81 | 154 |
DUF702 81 kkqsalsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154 k+qs+ st+++++ + ++++ + +P+e+ss a frcv+vss+ddg+e++aYqt+v+igGhvf+GiL+dqGl++ AT2G21400.1 54 KHQSQPLSTSIPKGVQIHTTPGH-FPAELSSLADFRCVKVSSIDDGKEQYAYQTTVNIGGHVFRGILHDQGLHK 126 67888999999999988776665.***********************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF05142 | 3.4E-25 | 6 | 61 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01623 | 1.4E-28 | 8 | 50 | IPR006510 | Zinc finger, lateral root primordium type 1 |
Pfam | PF05142 | 2.5E-22 | 71 | 125 | IPR007818 | Protein of unknown function DUF702 |
TIGRFAMs | TIGR01624 | 4.4E-30 | 76 | 124 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0009734 | Biological Process | auxin-activated signaling pathway | ||||
GO:0009851 | Biological Process | auxin biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MMMIMGRKCE DCGNQAKKDC VYMRCRTCCK SKAFHCQTHI KSTWVPAYRR SHHKHQSQPL 60 STSIPKGVQI HTTPGHFPAE LSSLADFRCV KVSSIDDGKE QYAYQTTVNI GGHVFRGILH 120 DQGLHKVMVD HHYNKNSNNH QELLTPSTSS CPLKITSPFT DFMFGTRFSS VLRR |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | AT2G21400 | |||||
AtGenExpress | AT2G21400 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | A member of SHI gene family. Arabidopsis thaliana has ten members that encode proteins with a RING finger-like zinc finger motif. Despite being highly divergent in sequence, many of the SHI-related genes are partially redundant in function and synergistically promote gynoecium, stamen and leaf development in Arabidopsis. | |||||
UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). {ECO:0000269|PubMed:16740146}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G21400.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DISRUPTION PHENOTYPE: No visible phenotype. {ECO:0000269|PubMed:16740146}. |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G21400 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY163777 | 0.0 | AY163777.1 Arabidopsis thaliana hypothetical protein (F3K23.16) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001324104.1 | 1e-130 | SHI-related sequence3 | ||||
Refseq | NP_179735.1 | 1e-130 | SHI-related sequence3 | ||||
Swissprot | Q9SJT8 | 1e-131 | SRS3_ARATH; Protein SHI RELATED SEQUENCE 3 | ||||
TrEMBL | A0A1P8AZ48 | 1e-129 | A0A1P8AZ48_ARATH; SHI-related sequence3 | ||||
STRING | AT2G21400.1 | 1e-129 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM9188 | 26 | 38 | Representative plant | OGRP1313 | 15 | 49 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G21400.1 |
Entrez Gene | 816679 |
iHOP | AT2G21400 |
wikigenes | AT2G21400 |