PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Tp3g00140 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 151aa MW: 17394.4 Da PI: 9.1931 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103 | 1.6e-32 | 72 | 130 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYY+Ct++gC+vkk+v+r + d+ vv++tY+g H+h+ Tp3g00140 72 LDDGYRWRKYGQKAVKNNPFPRSYYKCTQEGCRVKKQVQRLSGDEGVVVTTYQGVHTHP 130 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.5E-34 | 57 | 130 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.62E-29 | 64 | 131 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.722 | 67 | 132 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.5E-38 | 72 | 131 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.4E-26 | 73 | 130 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006817 | Biological Process | phosphate ion transport | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MEDRCQVLFP CSSSSSADHR LSGEQTQSAS QTNTSSSSHH STKEEEKVKS EKKMKEREPK 60 FAFQTRSQVD ILDDGYRWRK YGQKAVKNNP FPRSYYKCTQ EGCRVKKQVQ RLSGDEGVVV 120 TTYQGVHTHP VDKPSDNFHH ILTQMHIFPP F |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-28 | 62 | 129 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-28 | 62 | 129 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00325 | DAP | Transfer from AT3G01970 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Tp3g00140 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC246580 | 1e-124 | KC246580.1 Brassica napus WRKY transcription factor 45.1 (WRKY45.1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006300107.1 | 4e-80 | probable WRKY transcription factor 45 | ||||
Swissprot | Q9S763 | 1e-67 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
TrEMBL | A0A087H6A0 | 6e-84 | A0A087H6A0_ARAAL; Uncharacterized protein | ||||
STRING | A0A087H6A0 | 9e-85 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01970.1 | 1e-66 | WRKY DNA-binding protein 45 |
Publications ? help Back to Top | |||
---|---|---|---|
|