PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G01970.1 | ||||||||
Common Name | ATWRKY45, F1C9.25, F28J7.30, WRKY45 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 147aa MW: 17225.4 Da PI: 9.2058 | ||||||||
Description | WRKY DNA-binding protein 45 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 98.9 | 3.1e-31 | 64 | 122 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYY+Ct +gC+vkk+v+r+ d+ vv++tY+g H+h AT3G01970.1 64 LDDGYRWRKYGQKAVKNNPFPRSYYKCTEEGCRVKKQVQRQWGDEGVVVTTYQGVHTHA 122 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 8.7E-33 | 49 | 122 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.22E-28 | 56 | 123 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.838 | 59 | 124 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.7E-36 | 64 | 123 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.4E-25 | 65 | 121 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006817 | Biological Process | phosphate ion transport | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009047 | anatomy | stem | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MEDRRCDVLF PCSSSVDPRL TEFHGVDNSA QPTTSSEEKP RSKKKKKERE ARYAFQTRSQ 60 VDILDDGYRW RKYGQKAVKN NPFPRSYYKC TEEGCRVKKQ VQRQWGDEGV VVTTYQGVHT 120 HAVDKPSDNF HHILTQMHIF PPFCLKE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-27 | 54 | 121 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-27 | 54 | 121 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.26598 | 0.0 | leaf| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145337998 | 0.0 | ||||
Genevisible | 258975_at | 0.0 | ||||
Expression Atlas | AT3G01970 | - | ||||
AtGenExpress | AT3G01970 | - | ||||
ATTED-II | AT3G01970 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | member of WRKY Transcription Factor; Group I | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00325 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G01970.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G01970 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF426251 | 0.0 | AF426251.1 Arabidopsis thaliana WRKY transcription factor 45 (WRKY45) mRNA, complete cds. | |||
GenBank | AK118457 | 0.0 | AK118457.1 Arabidopsis thaliana At3g01970 mRNA for putative WRKY-like transcriptional regulator protein, complete cds, clone: RAFL19-70-A15. | |||
GenBank | BT024684 | 0.0 | BT024684.1 Arabidopsis thaliana At3g01970 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_186846.1 | 1e-108 | WRKY DNA-binding protein 45 | ||||
Swissprot | Q9S763 | 1e-109 | WRK45_ARATH; Probable WRKY transcription factor 45 | ||||
TrEMBL | A0A384KXL3 | 1e-107 | A0A384KXL3_ARATH; WRKY45 | ||||
TrEMBL | Q29Q72 | 1e-107 | Q29Q72_ARATH; At3g01970 | ||||
STRING | AT3G01970.1 | 1e-108 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 | Representative plant | OGRP14 | 17 | 875 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G01970.1 |
Entrez Gene | 821270 |
iHOP | AT3G01970 |
wikigenes | AT3G01970 |