PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g21830
Organism
Thellungiella parvula
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family bHLH
Protein Properties Length: 94aa    MW: 10722.9 Da    PI: 9.249
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g21830genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH26.41.2e-0820601454
               HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
        HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
               d+i +   +L++l+P++ + +s K+s + +L+++++YI++L
  Tp1g21830 20 DQISDLVTKLQQLIPELRRRRSDKVSASKVLQETCNYIRNL 60
               68999999********889********************99 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.101.2E-8475IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.41660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474594.71E-92078IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000103.8E-62060IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MSSRRSSRSR QSGTSRISDD QISDLVTKLQ QLIPELRRRR SDKVSASKVL QETCNYIRNL  60
HREVDDLSDR LSDLLASTDD NSAEAAIIRS LLNY
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269|PubMed:16786307, ECO:0000269|PubMed:23224238}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp1g21830
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269|PubMed:16786307}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1191101e-132AK119110.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL21-46-D20.
GenBankBT0046861e-132BT004686.1 Arabidopsis thaliana At1g26948 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595899.12e-45PREDICTED: transcription factor PRE6
RefseqXP_013690768.12e-45transcription factor PRE6
SwissprotQ8GW321e-45PRE6_ARATH; Transcription factor PRE6
TrEMBLA0A078GTH86e-44A0A078GTH8_BRANA; BnaC07g12550D protein
TrEMBLA0A0D3D6W86e-44A0A0D3D6W8_BRAOL; Uncharacterized protein
TrEMBLA0A3P6F0P26e-44A0A3P6F0P2_BRAOL; Uncharacterized protein
STRINGBo7g054400.19e-45(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25928225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-34bHLH family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gommers CM, et al.
    Molecular Profiles of Contrasting Shade Response Strategies in Wild Plants: Differential Control of Immunity and Shoot Elongation.
    Plant Cell, 2017. 29(2): p. 331-344
    [PMID:28138015]
  3. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  4. Zheng K, et al.
    Involvement of PACLOBUTRAZOL RESISTANCE6/KIDARI, an Atypical bHLH Transcription Factor, in Auxin Responses in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1813
    [PMID:29114256]