PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010552351.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 170aa MW: 19617.8 Da PI: 6.801 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.5 | 3.3e-14 | 77 | 135 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +++rrk++NRe+ArrsR RK+ ++eL v L ++N++L ++l++ ++ +k+ +e+ XP_010552351.1 77 RKQRRKISNRESARRSRMRKQRHLDELLSQVMYLMNQNHQLLEKLNHASESHEKVLQEN 135 689***************************************************99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 4.2E-13 | 73 | 137 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.852 | 75 | 138 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 6.7E-11 | 76 | 130 | No hit | No description |
SuperFamily | SSF57959 | 7.74E-12 | 77 | 126 | No hit | No description |
Pfam | PF00170 | 6.9E-12 | 77 | 135 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 1.94E-17 | 78 | 128 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 80 | 95 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MQPATDVFSL SNYIISSNPS PYPSHFTIPS SFDLNGQIPN PFHGFQTTTA AQSVSFSSNN 60 STSDEAEEQQ INIINERKQR RKISNRESAR RSRMRKQRHL DELLSQVMYL MNQNHQLLEK 120 LNHASESHEK VLQENARLKE EATELRQMIT DMQIRSPFSC FGDDFRAESP |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 89 | 96 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010552351.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010552351.1 | 1e-123 | PREDICTED: basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 1e-59 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A078JMC7 | 6e-81 | A0A078JMC7_BRANA; BnaA06g39730D protein | ||||
TrEMBL | A0A397Z2R0 | 6e-81 | A0A397Z2R0_BRACM; Uncharacterized protein | ||||
STRING | XP_010552351.1 | 1e-123 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3112 | 26 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 2e-48 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|