PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010545404.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 167aa MW: 18454.8 Da PI: 9.4139 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 102.4 | 2.6e-32 | 83 | 141 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r +dp++v++tYeg Hnh+ XP_010545404.1 83 LDDGYRWRKYGQKSVKNNVHPRSYYRCTYHTCNVKKQVQRLVKDPSIVVTTYEGIHNHP 141 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.6E-32 | 70 | 141 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 3.14E-28 | 77 | 142 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.231 | 78 | 143 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.1E-37 | 83 | 142 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.2E-26 | 84 | 141 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MEGGDPMLAL DNPFMSSSPP LLMTASFSGE TAGASSSFSP ENLPDNGGGG GRGEGVKINK 60 GKGKRSAATP RIAFHTRSVD DVLDDGYRWR KYGQKSVKNN VHPRSYYRCT YHTCNVKKQV 120 QRLVKDPSIV VTTYEGIHNH PCEKLMETLS PLLRQLQFLS TVSEFHH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-24 | 73 | 140 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-24 | 73 | 140 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010545404.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010545404.1 | 1e-124 | PREDICTED: probable WRKY transcription factor 43 isoform X1 | ||||
Swissprot | Q8VWQ4 | 7e-70 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | M4EFW2 | 7e-72 | M4EFW2_BRARP; Uncharacterized protein | ||||
STRING | XP_010545404.1 | 1e-123 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 3e-72 | WRKY DNA-binding protein 56 |