PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010540558.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 189aa MW: 21849.6 Da PI: 5.9777 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 54.7 | 1.3e-17 | 35 | 81 | 3 | 49 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 i+ + r +tfskRr gi KKA+EL v+Cd++va ++fs++g+ +++ XP_010540558.1 35 INIEEDRMITFSKRRSGIYKKANELVVMCDVDVAFLVFSKSGTPFTF 81 56667899**********************************98888 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 23.338 | 25 | 85 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.8E-22 | 25 | 84 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.35E-24 | 26 | 100 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.09E-31 | 26 | 97 | No hit | No description |
PRINTS | PR00404 | 1.2E-16 | 27 | 47 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.5E-20 | 34 | 81 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-16 | 47 | 62 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-16 | 62 | 83 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 189 aa Download sequence Send to blast |
MDKHSIHNSD QSSPSYPTMA EKKTKGKQKI EIKKINIEED RMITFSKRRS GIYKKANELV 60 VMCDVDVAFL VFSKSGTPFT FGHPSMEAVT ERFKNPNLPR SSMDNATLVT RAYRTQRISE 120 LAKDYEKLGD ELEVEREKGA KAEEEEVEET RNGWWNAPID DLSDENRHRM HDAFVELHDN 180 LCDLLAQRL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 1e-14 | 26 | 109 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3kov_B | 1e-14 | 26 | 109 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3kov_I | 1e-14 | 26 | 109 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3kov_J | 1e-14 | 26 | 109 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_A | 1e-14 | 26 | 109 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_B | 1e-14 | 26 | 109 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_C | 1e-14 | 26 | 109 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_D | 1e-14 | 26 | 109 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_I | 1e-14 | 26 | 109 | 1 | 84 | Myocyte-specific enhancer factor 2A |
3p57_J | 1e-14 | 26 | 109 | 1 | 84 | Myocyte-specific enhancer factor 2A |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010540558.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010540558.1 | 1e-141 | PREDICTED: agamous-like MADS-box protein AGL61 | ||||
STRING | XP_010540558.1 | 1e-140 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM86 | 28 | 390 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G04100.1 | 6e-38 | AGAMOUS-like 57 |