PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010539958.1

Organism

Tarenaya hassleriana

Taxonomic ID

28532

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya

Family

ZF-HD

Protein Properties

Length: 100aa MW: 10785.1 Da PI: 9.0973

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010539958.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	101.6	5.3e-32	30	87	2	60
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 + vrY eC+kNhAa++Gg+avDGC+Efm+s g egta a+ CaACgCHRnFHR+ev++e XP_010539958.1 30 SVVRYGECRKNHAANIGGYAVDGCREFMAS-GGEGTAGAFSCAACGCHRNFHRKEVATE 87 579************************9.8899******************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	4.0E-28	1	96	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	2.5E-29	32	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	6.6E-25	33	84	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.905	34	83	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 100 aa Download sequence Send to blast
MKKRQVVIKQ RRSSISNPTP TSSSTSVVNS VVRYGECRKN HAANIGGYAV DGCREFMASG 60 GEGTAGAFSC AACGCHRNFH RKEVATEVVC EYSPPNVSYH

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269\|PubMed:16412086, ECO:0000269\|PubMed:21059647, ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_010539958.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010539958.1	1e-68	PREDICTED: mini zinc finger protein 3-like
Swissprot	Q9CA51	1e-39	MIF1_ARATH; Mini zinc finger protein 1
TrEMBL	A0A067KG85	3e-42	A0A067KG85_JATCU; Uncharacterized protein
STRING	XP_010539958.1	6e-68	(Tarenaya hassleriana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM944	28	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74660.1	6e-39	mini zinc finger 1