PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010535117.1

Organism

Tarenaya hassleriana

Taxonomic ID

28532

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya

Family

NAC

Protein Properties

Length: 296aa MW: 33027.9 Da PI: 8.8096

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010535117.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	163.8	6.4e-51	14	139	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrF Ptdeel+v+yL++kv+g+ ++l ++i+++d+y+++Pw Lp+k+ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + + XP_010535117.1 14 LPPGFRFYPTDEELMVQYLCRKVAGHIFSL-QIIADIDLYNFDPWILPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIIST- 106 79***********************999.89***********7777799*****************************999988. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g+ vg+kk+Lvfy g+apkg+kt+W+mheyrl XP_010535117.1 107 EGRRVGIKKSLVFYVGKAPKGTKTNWIMHEYRL 139 9999*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.57E-58	10	148	IPR003441	NAC domain
PROSITE profile	PS51005	53.607	14	169	IPR003441	NAC domain
Pfam	PF02365	2.3E-26	15	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 296 aa Download sequence Send to blast
MGITETDPLT RLSLPPGFRF YPTDEELMVQ YLCRKVAGHI FSLQIIADID LYNFDPWILP 60 SKAIFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIISTEGRR VGIKKSLVFY 120 VGKAPKGTKT NWIMHEYRLV EPSRKNGSSK SSGGQRQVHN NVLTDREYSN NGPSISSLSQ 180 FNNDHSFIFP GSNRSIPVLT EQKTGFINNL DWASLATTHS SVPELGPSPG YDDGFFHLKT 240 DEEVESGYRT QWAENAASAS GMLQFGSGAL TRGFGVNSID GFGFRYPGQP GGFEFM

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-99	1	150	4	153	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-99	1	150	4	153	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-99	1	150	4	153	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-99	1	150	4	153	NO APICAL MERISTEM PROTEIN
3swm_A	2e-99	1	150	7	156	NAC domain-containing protein 19
3swm_B	2e-99	1	150	7	156	NAC domain-containing protein 19
3swm_C	2e-99	1	150	7	156	NAC domain-containing protein 19
3swm_D	2e-99	1	150	7	156	NAC domain-containing protein 19
3swp_A	2e-99	1	150	7	156	NAC domain-containing protein 19
3swp_B	2e-99	1	150	7	156	NAC domain-containing protein 19
3swp_C	2e-99	1	150	7	156	NAC domain-containing protein 19
3swp_D	2e-99	1	150	7	156	NAC domain-containing protein 19
4dul_A	1e-99	1	150	4	153	NAC domain-containing protein 19
4dul_B	1e-99	1	150	4	153	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269\|PubMed:15319476}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_010535117.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought, high salinity and abscisic acid (ABA). Slightly up-regulated by jasmonic acid. Not induced by cold treatment. {ECO:0000269\|PubMed:12646039, ECO:0000269\|PubMed:15319476}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010535117.1	0.0	PREDICTED: NAC domain-containing protein 19-like isoform X2
Swissprot	Q9C932	1e-119	NAC19_ARATH; NAC domain-containing protein 19
TrEMBL	A0A061F7J6	1e-120	A0A061F7J6_THECC; NAC domain class transcription factor isoform 1
STRING	XP_010535116.1	0.0	(Tarenaya hassleriana)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G52890.1	1e-112	NAC domain containing protein 19

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Zheng XY, et al. Coronatine promotes Pseudomonas syringae virulence in plants by activating a signaling cascade that inhibits salicylic acid accumulation. Cell Host Microbe, 2012. 11(6): p. 587-96 [PMID:22704619] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Guan Q,Yue X,Zeng H,Zhu J The protein phosphatase RCF2 and its interacting partner NAC019 are critical for heat stress-responsive gene regulation and thermotolerance in Arabidopsis. Plant Cell, 2014. 26(1): p. 438-53 [PMID:24415771] Chen F, et al. Arabidopsis Phytochrome A Directly Targets Numerous Promoters for Individualized Modulation of Genes in a Wide Range of Pathways. Plant Cell, 2014. 26(5): p. 1949-1966 [PMID:24794133] Wang T, et al. Salt-Related MYB1 Coordinates Abscisic Acid Biosynthesis and Signaling during Salt Stress in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1027-41 [PMID:26243618] Zhu X, et al. Jasmonic acid promotes degreening via MYC2/3/4- and ANAC019/055/072-mediated regulation of major chlorophyll catabolic genes. Plant J., 2015. 84(3): p. 597-610 [PMID:26407000] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Gimenez-Ibanez S, et al. JAZ2 controls stomata dynamics during bacterial invasion. New Phytol., 2017. 213(3): p. 1378-1392 [PMID:28005270] Ueda M, et al. The Distinct Roles of Class I and II RPD3-Like Histone Deacetylases in Salinity Stress Response. Plant Physiol., 2017. 175(4): p. 1760-1773 [PMID:29018096] Kang M, et al. The C-Domain of the NAC Transcription Factor ANAC019 Is Necessary for pH-Tuned DNA Binding through a Histidine Switch in the N-Domain. Cell Rep, 2018. 22(5): p. 1141-1150 [PMID:29386103] Sukiran NL,Ma JC,Ma H,Su Z ANAC019 is required for recovery of reproductive development under drought stress in Arabidopsis. Plant Mol. Biol., 2019. 99(1-2): p. 161-174 [PMID:30604322]