PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010526144.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 217aa MW: 24152.8 Da PI: 10.102 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.9 | 1.1e-18 | 42 | 87 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd +l ++v+++G+++W++I +++ gR++k+c++rw + XP_010526144.1 42 KGPWSAEEDRILTRLVEKYGPRNWSLIGKHIK-GRSGKSCRLRWCNQ 87 79*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 60.1 | 4.9e-19 | 96 | 138 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T+eEde ++ a++++G++ W+tIar ++ gRt++ +k++w++ XP_010526144.1 96 PFTAEEDETILAAHERYGNR-WATIARLLP-GRTDNAVKNHWNST 138 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 28.076 | 37 | 92 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 8.99E-33 | 39 | 135 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.9E-17 | 41 | 90 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.7E-18 | 42 | 87 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.3E-26 | 43 | 95 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.58E-15 | 44 | 86 | No hit | No description |
SMART | SM00717 | 1.7E-16 | 93 | 141 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 21.796 | 94 | 143 | IPR017930 | Myb domain |
CDD | cd00167 | 2.28E-12 | 96 | 139 | No hit | No description |
Pfam | PF00249 | 8.0E-16 | 96 | 138 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.4E-23 | 96 | 142 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MDVTMSSYRC GSPTSSSSGS SSSDTSNTHK NSPSREKPGR VKGPWSAEED RILTRLVEKY 60 GPRNWSLIGK HIKGRSGKSC RLRWCNQLSP AVEHRPFTAE EDETILAAHE RYGNRWATIA 120 RLLPGRTDNA VKNHWNSTLR RRARERRQTQ TQMQREEEVM TALTLAPPGS GGYGGGGGGG 180 RTEEGVTAEF WETMKEVIAR EVREYVSSTF TSGSGFQ |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 7e-45 | 41 | 143 | 3 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 8e-45 | 38 | 143 | 54 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 8e-45 | 38 | 143 | 54 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 6e-45 | 41 | 143 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 6e-45 | 41 | 143 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010526144.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010526144.1 | 1e-159 | PREDICTED: transcriptional activator Myb-like | ||||
Swissprot | O23160 | 3e-56 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | A0A0D2R0I6 | 1e-89 | A0A0D2R0I6_GOSRA; Uncharacterized protein | ||||
STRING | XP_010526144.1 | 1e-159 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14553 | 11 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37260.1 | 1e-56 | myb domain protein 73 |
Publications ? help Back to Top | |||
---|---|---|---|
|