PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010521380.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 104aa MW: 12688.2 Da PI: 10.7251 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 24.9 | 4.7e-08 | 35 | 74 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++++E++l+++ ++ G + W++Ia +++ gR ++++ +w XP_010521380.1 35 MSEQEEDLIYRMYRLVGDR-WDLIAGRIP-GRQAEEIERYWI 74 699**************99.*********.***********5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 2.4E-5 | 31 | 79 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 8.99E-5 | 34 | 73 | No hit | No description |
Pfam | PF00249 | 1.7E-7 | 35 | 74 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS50090 | 6.144 | 36 | 73 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 4.37E-7 | 36 | 74 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.4E-9 | 36 | 74 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MDNTNQQRRR RLKQPKSTFH ESEEVSSREW EFISMSEQEE DLIYRMYRLV GDRWDLIAGR 60 IPGRQAEEIE RYWIMRNSEG FAERRRQQRL KKKSSRGHAS SSRP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010521380.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010521380.1 | 3e-70 | PREDICTED: transcription factor TRY-like | ||||
Swissprot | Q8GV05 | 9e-46 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | D7MSV5 | 2e-44 | D7MSV5_ARALL; Uncharacterized protein | ||||
STRING | XP_010521380.1 | 1e-69 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 2e-44 | MYB_related family protein |