PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG037343t1 | ||||||||
Common Name | TCM_037343 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 160aa MW: 18248.8 Da PI: 4.807 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 100.4 | 1.1e-31 | 98 | 156 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+ +gC+vkk+ver++edp++v++tYeg Hnh+ Thecc1EG037343t1 98 LDDGYRWRKYGKKMVKNSPNPRNYYRCSVEGCTVKKRVERDREDPSYVVTTYEGIHNHQ 156 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.1E-33 | 84 | 157 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.02E-29 | 90 | 157 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 30.745 | 93 | 158 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.1E-36 | 98 | 157 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.3E-24 | 99 | 156 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 160 aa Download sequence Send to blast |
MSTVNFKPPD SPESDHANQS NFEFPDDYFT FDSWLEDCPE AISSGTTENP VNQANEVNDS 60 AGASSLLQGP AGESETIRER REFKERYAFR TKSEVEILDD GYRWRKYGKK MVKNSPNPRN 120 YYRCSVEGCT VKKRVERDRE DPSYVVTTYE GIHNHQSAS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-27 | 88 | 155 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 4e-27 | 88 | 155 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00531 | DAP | Transfer from AT5G26170 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007012369.1 | 1e-117 | PREDICTED: probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 6e-42 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A061GKP7 | 1e-115 | A0A061GKP7_THECC; WRKY DNA-binding protein 50, putative | ||||
STRING | EOY29988 | 1e-116 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6121 | 27 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 2e-44 | WRKY DNA-binding protein 50 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG037343t1 |
Entrez Gene | 18588110 |
Publications ? help Back to Top | |||
---|---|---|---|
|