PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG025674t1 | ||||||||
Common Name | TCM_025674 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 151aa MW: 16948.7 Da PI: 10.2575 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 43.4 | 4.5e-14 | 11 | 50 | 3 | 42 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42 i +s r+ tf k ++g+lKKA+ELS+LC++e +ii+ + Thecc1EG025674t1 11 ITKDSARKSTFKKGKKGLLKKASELSTLCGIEGFMIIYNP 50 778999***************************9999965 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 15.6 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 4.2E-14 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.31E-17 | 1 | 71 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-8 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.7E-14 | 11 | 51 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-8 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.9E-8 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MTRKKVKLSY ITKDSARKST FKKGKKGLLK KASELSTLCG IEGFMIIYNP YDAQLEQRIE 60 QANKQLKRQC RDNREKETTQ VMFQCLAKQG LEILNVTDLS DLGWLLEQNL KDIDKKIYTL 120 AKPSHSQSFA PAASTTMATP ETMLKSGGKV * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017976533.1 | 1e-73 | PREDICTED: agamous-like MADS-box protein AGL80 | ||||
Swissprot | Q9FJK3 | 5e-30 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
TrEMBL | A0A061F0V0 | 1e-106 | A0A061F0V0_THECC; AGAMOUS-like 80, putative | ||||
STRING | EOY10302 | 1e-107 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM70 | 28 | 415 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48670.1 | 5e-32 | AGAMOUS-like 80 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG025674t1 |
Entrez Gene | 18599674 |
Publications ? help Back to Top | |||
---|---|---|---|
|