PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G48670.1

Common Name

AGL80, FEM111, K15N18.16

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

M-type_MADS

Protein Properties

Length: 321aa MW: 36824.5 Da PI: 6.9302

Description

AGAMOUS-like 80

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G48670.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	56.9	2.6e-18	11	51	3	43
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43 i+n+s r+ tf kR++g++KK +ELS+LC++ ++ ii+s+ AT5G48670.1 11 ISNDSSRKATFKKRKKGLMKKVHELSTLCGITACAIIYSPY 51 9**************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.6E-25	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	17.465	1	49	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.02E-25	2	95	IPR002100	Transcription factor, MADS-box
CDD	cd00266	6.00E-24	2	85	No hit	No description
PRINTS	PR00404	2.1E-9	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.1E-18	11	51	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-9	23	38	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043078	Cellular Component	polar nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009089	anatomy	endosperm
PO:0020090	anatomy	embryo sac central cell

Sequence ? help Back to Top
Protein Sequence Length: 321 aa Download sequence Send to blast
MTRKKVKLAY ISNDSSRKAT FKKRKKGLMK KVHELSTLCG ITACAIIYSP YDTNPEVWPS 60 NSGVQRVVSE FRTLPEMDQH KKMVDQEGFL KQRIAKATET LRRQRKDSRE LEMTEVMFQC 120 LIGNMEMFHL NIVDLNDLGY MIEQYLKDVN RRIEILRNSG TEIGESSSVA VAASEGNIPM 180 PNLVATTAPT TTIYEVGSSS SFAAVANFVN PIDLQQFRHP AAQHVGLNEQ PQNLNLNLNQ 240 NYNQNQEWFM EMMNHPEQMR YQTEQMGYQF MDDNHHNHIH HQPQEHQHQI HDESSNALDA 300 ANSSSIIPVT SSSITNKTWF H

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	2	24	RKKVKLAYISNDSSRKATFKKRK
2	21	25	KKRKK

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145359022	0.0
Genevisible	248661_at	0.0
Expression Atlas	AT5G48670	-
AtGenExpress	AT5G48670	-
ATTED-II	AT5G48670	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269\|PubMed:16798889}.

Functional Description ? help Back to Top
Source	Description
TAIR	AGL80 is a member of the MADS box family of genes. AGL80 functions as a transcription factor within the central cell gene regulatory network and controls the expression of downstream genes required for central cell development and function.
UniProt	Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269\|PubMed:16798889, ECO:0000305\|PubMed:26462908}.

Function -- GeneRIF ? help Back to Top
AGL80 functions as a transcription factor within the central cell gene regulatory network and controls the expression of downstream genes required for central cell development and function. [PMID: 16798889] The expression pattern and mutant phenotype of AGL61 are similar to those of AGL80, suggesting that AGL61 may function as a heterodimer with AGL80 within the central cell. [PMID: 18599653] Data show that AGL61 and AGL80 appear to function together to differentiate the central cell in Arabidopsis. Data renamed AGL61 DIANA, after the virginal Roman goddess of the hunt. [PMID: 18713950]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00553	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G48670.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G22015(A), AT5G04560(A)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G60440
IntAct	Search Q9FJK3

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G48670

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB015468	0.0	AB015468.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K15N18.
GenBank	CP002688	0.0	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBank	DQ056710	0.0	DQ056710.1 Arabidopsis thaliana MADS-box family protein (At5g48670) mRNA, complete cds.
GenBank	DQ406752	0.0	DQ406752.1 Arabidopsis thaliana MADS box transcription factor AGL80 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_199678.1	0.0	AGAMOUS-like 80
Swissprot	Q9FJK3	0.0	AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBL	A0A178UE43	0.0	A0A178UE43_ARATH; FEM111
STRING	AT5G48670.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM70	28	415
Representative plant	OGRP114	13	173

Link Out ? help Back to Top
Phytozome	AT5G48670.1
Entrez Gene	834925
iHOP	AT5G48670
wikigenes	AT5G48670

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Portereiko MF, et al. AGL80 is required for central cell and endosperm development in Arabidopsis. Plant Cell, 2006. 18(8): p. 1862-72 [PMID:16798889] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Kang IH,Steffen JG,Portereiko MF,Lloyd A,Drews GN The AGL62 MADS domain protein regulates cellularization during endosperm development in Arabidopsis. Plant Cell, 2008. 20(3): p. 635-47 [PMID:18334668] Steffen JG,Kang IH,Portereiko MF,Lloyd A,Drews GN AGL61 interacts with AGL80 and is required for central cell development in Arabidopsis. Plant Physiol., 2008. 148(1): p. 259-68 [PMID:18599653] Bemer M,Wolters-Arts M,Grossniklaus U,Angenent GC The MADS domain protein DIANA acts together with AGAMOUS-LIKE80 to specify the central cell in Arabidopsis ovules. Plant Cell, 2008. 20(8): p. 2088-101 [PMID:18713950] Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis. Plant Physiol., 2010. 154(1): p. 287-300 [PMID:20631316] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Li HJ, et al. Arabidopsis CBP1 Is a Novel Regulator of Transcription Initiation in Central Cell-Mediated Pollen Tube Guidance. Plant Cell, 2015. 27(10): p. 2880-93 [PMID:26462908] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]