PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG015351t1 | ||||||||
Common Name | TCM_015351 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 101aa MW: 12350.1 Da PI: 10.0458 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.6 | 1.4e-08 | 31 | 69 | 5 | 45 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 T++E++l+++ +++ G + W++Ia +++ gR ++++ +w Thecc1EG015351t1 31 TEQEEDLIYRMHRLVGER-WDLIAGRIP-GRKAEEIERFWI 69 99****************.*********.*********995 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.3E-5 | 26 | 74 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.03E-5 | 31 | 68 | No hit | No description |
Pfam | PF00249 | 6.6E-8 | 31 | 69 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-10 | 31 | 69 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 5.85E-7 | 31 | 69 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MDRQRRRKQP KITTREYEEV SSIEWEFIKV TEQEEDLIYR MHRLVGERWD LIAGRIPGRK 60 AEEIERFWIM QNNEGFAQRR REHKESISKN IWPLAFNGFK * |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 1 | 6 | DRQRRR |
2 | 3 | 8 | QRRRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007038961.1 | 2e-67 | PREDICTED: MYB-like transcription factor ETC3 | ||||
Swissprot | Q8GV05 | 1e-39 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A061G2M4 | 4e-66 | A0A061G2M4_THECC; Homeodomain-like superfamily protein | ||||
STRING | EOY23462 | 6e-67 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM323 | 28 | 194 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 6e-42 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG015351t1 |
Entrez Gene | 18605720 |