PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG007543t2 | ||||||||
Common Name | TCM_007543 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 190aa MW: 21916.1 Da PI: 8.0418 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 126.9 | 1.6e-39 | 57 | 175 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrF Ptdeelvv++L++k++ +++ +vi+++d+y ++Pw+L+ k+ ae ++wyf+s+r +nr t++gyWk g d++v+ Thecc1EG007543t2 57 LPPGFRFYPTDEELVVHFLQRKAALLPCHP-DVIPDLDLYPYDPWELNGKALAEGNQWYFYSRRT--------QNRNTSNGYWKPMGIDEPVV 140 79*************************999.99**************977778899******984........58999*************** PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++++vg+kk + fy g+ p g kt+W+m+eyrl Thecc1EG007543t2 141 NSSSKKVGMKKYFLFYIGEGPAGIKTNWIMQEYRL 175 *********************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.4E-47 | 51 | 180 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 42.858 | 57 | 189 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.0E-23 | 58 | 175 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
FFILLCFVSS LSYLFLSHTI NITHYKSFFF TILLFLELLS IAIGYISREM GDNNVNLPPG 60 FRFYPTDEEL VVHFLQRKAA LLPCHPDVIP DLDLYPYDPW ELNGKALAEG NQWYFYSRRT 120 QNRNTSNGYW KPMGIDEPVV NSSSKKVGMK KYFLFYIGEG PAGIKTNWIM QEYRLSDCDS 180 SSSRSSKRS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-37 | 53 | 175 | 13 | 142 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-37 | 53 | 175 | 13 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-37 | 53 | 175 | 13 | 142 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-37 | 53 | 175 | 13 | 142 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-37 | 53 | 175 | 16 | 145 | NAC domain-containing protein 19 |
3swm_B | 2e-37 | 53 | 175 | 16 | 145 | NAC domain-containing protein 19 |
3swm_C | 2e-37 | 53 | 175 | 16 | 145 | NAC domain-containing protein 19 |
3swm_D | 2e-37 | 53 | 175 | 16 | 145 | NAC domain-containing protein 19 |
3swp_A | 2e-37 | 53 | 175 | 16 | 145 | NAC domain-containing protein 19 |
3swp_B | 2e-37 | 53 | 175 | 16 | 145 | NAC domain-containing protein 19 |
3swp_C | 2e-37 | 53 | 175 | 16 | 145 | NAC domain-containing protein 19 |
3swp_D | 2e-37 | 53 | 175 | 16 | 145 | NAC domain-containing protein 19 |
4dul_A | 1e-37 | 53 | 175 | 13 | 142 | NAC domain-containing protein 19 |
4dul_B | 1e-37 | 53 | 175 | 13 | 142 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ801818 | 1e-117 | KJ801818.1 Gossypium hirsutum NAC transcription factor (XND1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007043034.1 | 1e-102 | PREDICTED: NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 5e-62 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A061E3E2 | 1e-138 | A0A061E3E2_THECC; NAC domain-containing protein 18 isoform 2 (Fragment) | ||||
STRING | EOX98866 | 1e-139 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 3e-63 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG007543t2 |
Entrez Gene | 18608343 |
Publications ? help Back to Top | |||
---|---|---|---|
|