PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG007543t1 | ||||||||
Common Name | TCM_007543 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 190aa MW: 21785.3 Da PI: 4.7919 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 126.9 | 1.6e-39 | 8 | 126 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrF Ptdeelvv++L++k++ +++ +vi+++d+y ++Pw+L+ k+ ae ++wyf+s+r +nr t++gyWk g d++v+ Thecc1EG007543t1 8 LPPGFRFYPTDEELVVHFLQRKAALLPCHP-DVIPDLDLYPYDPWELNGKALAEGNQWYFYSRRT--------QNRNTSNGYWKPMGIDEPVV 91 79*************************999.99**************977778899******984........58999*************** PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++++vg+kk + fy g+ p g kt+W+m+eyrl Thecc1EG007543t1 92 NSSSKKVGMKKYFLFYIGEGPAGIKTNWIMQEYRL 126 *********************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.83E-49 | 5 | 157 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 46.747 | 8 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.0E-23 | 9 | 126 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MGDNNVNLPP GFRFYPTDEE LVVHFLQRKA ALLPCHPDVI PDLDLYPYDP WELNGKALAE 60 GNQWYFYSRR TQNRNTSNGY WKPMGIDEPV VNSSSKKVGM KKYFLFYIGE GPAGIKTNWI 120 MQEYRLSDCD SSSSRSSKRR AHSKIDHSKW VVCRVYERSS DDDDDGTELS CLDEVFLSLD 180 DLDEISLPN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 1e-43 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swm_B | 1e-43 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swm_C | 1e-43 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swm_D | 1e-43 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swp_A | 1e-43 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swp_B | 1e-43 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swp_C | 1e-43 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
3swp_D | 1e-43 | 4 | 160 | 16 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007043034.1 | 1e-140 | PREDICTED: NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 1e-85 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A061E1M1 | 1e-138 | A0A061E1M1_THECC; NAC domain protein, IPR003441 isoform 1 | ||||
STRING | Gorai.005G217400.1 | 1e-110 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3674 | 28 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 7e-85 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG007543t1 |
Entrez Gene | 18608343 |
Publications ? help Back to Top | |||
---|---|---|---|
|