PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Thecc1EG001514t1 | ||||||||
Common Name | TCM_001514 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 201aa MW: 23141.3 Da PI: 4.3597 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 104.2 | 1.7e-32 | 10 | 128 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrF Ptdeelv ++L +k+ +++ ++i+e+d++ ++Pw+L+ k+ + ++++fF++ +nr+ ++gyWk+ ++++++ Thecc1EG001514t1 10 LPPGFRFCPTDEELVLHFLYPKALLLPCHP-NIIPELDLHLLHPWELNGKALLSGNHCFFFTQM--------MENRVLENGYWKQLDTEEPIF 93 79*************************999.89**************966667889999*9986........4589***************** PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 g+++g+kk +vfy ++ap g +t+W+m+ey+l Thecc1EG001514t1 94 GGAGKKIGMKKFFVFYINEAPFGIETNWLMQEYHL 128 *********************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 3.4E-43 | 7 | 157 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 37.673 | 10 | 159 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.1E-21 | 11 | 128 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MEMKDGCINL PPGFRFCPTD EELVLHFLYP KALLLPCHPN IIPELDLHLL HPWELNGKAL 60 LSGNHCFFFT QMMENRVLEN GYWKQLDTEE PIFGGAGKKI GMKKFFVFYI NEAPFGIETN 120 WLMQEYHLCN WDSTLTSYKT TGNQKLDCSK WVLCRVEESK GNSQSFSYSD EDDGTELSCL 180 DEMFLSMDDD LDDISSSKFF * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-32 | 8 | 164 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-32 | 8 | 164 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-32 | 8 | 164 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-32 | 8 | 164 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-32 | 8 | 164 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-32 | 8 | 164 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-32 | 8 | 164 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-32 | 8 | 164 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-32 | 8 | 164 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-32 | 8 | 164 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-32 | 8 | 164 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-32 | 8 | 164 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 1e-32 | 8 | 164 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 1e-32 | 8 | 164 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007048423.2 | 1e-147 | PREDICTED: NAC domain-containing protein 104 | ||||
Swissprot | Q8GWK6 | 1e-56 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A061DJ46 | 1e-147 | A0A061DJ46_THECC; Xylem NAC domain 1, putative | ||||
STRING | EOX92580 | 1e-148 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3674 | 28 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 9e-52 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Thecc1EG001514t1 |
Entrez Gene | 18611886 |
Publications ? help Back to Top | |||
---|---|---|---|
|