PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7DL_D1A375ECF.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 157aa MW: 17609.1 Da PI: 9.8754 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 162.7 | 1.3e-50 | 11 | 145 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkk......lelee.....vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknra 77 lppGfrFhP d+elv +yL +k+ g + ++ +vd++k+ePwdLp+ + + kewyf+s rd+kyatg+r+nra Traes_7DL_D1A375ECF.1 11 LPPGFRFHPLDDELVLDYLSRKLGGGAggaaaaX---SiygcpAMVDVDLNKIEPWDLPEIACIGGKEWYFYSLRDRKYATGQRTNRA 95 79**********************9997765441...15555579**************7666789********************** PP NAM 78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 t+sgyWkatgkd+++ + kg lvg++ktLvfy+grapkg+kt+Wvmhe+r Traes_7DL_D1A375ECF.1 96 TESGYWKATGKDRAISR-KGLLVGMRKTLVFYEGRAPKGKKTEWVMHEFRK 145 ***************99.999****************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.03E-52 | 2 | 149 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 49.034 | 11 | 157 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.5E-25 | 12 | 144 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MSSLSMVEAR LPPGFRFHPL DDELVLDYLS RKLGGGAGGA AAAXSIYGCP AMVDVDLNKI 60 EPWDLPEIAC IGGKEWYFYS LRDRKYATGQ RTNRATESGY WKATGKDRAI SRKGLLVGMR 120 KTLVFYEGRA PKGKKTEWVM HEFRKEGQGD LMKLPLK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 2e-48 | 7 | 144 | 11 | 139 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM027572 | 0.0 | HM027572.1 Triticum aestivum NAC transcription factor 7 (NAC7) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020188633.1 | 1e-102 | NAC domain-containing protein 21/22-like | ||||
Swissprot | Q84TE6 | 3e-68 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
TrEMBL | A0A453SXG3 | 1e-101 | A0A453SXG3_AEGTS; Uncharacterized protein | ||||
STRING | Traes_7DL_D1A375ECF.1 | 1e-111 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1012 | 37 | 138 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12977.1 | 3e-71 | NAC family protein |