PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G12977.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 279aa    MW: 31945.8 Da    PI: 8.6857
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G12977.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.71.3e-50181431128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhP+d+elv++yL +++ ++  +   v+ +vd++k+ePwd+p++++ + kewyf+s++d+kyatg r+nrat++gyWkatgkd+++ + +g 
  AT3G12977.1  18 LPPGFRFHPRDDELVCDYLMRRTVRSLYQP-VVLIDVDLNKCEPWDIPQTARVGGKEWYFYSQKDRKYATGYRTNRATATGYWKATGKDRAIQR-NGG 113
                  79*****************99977777555.5899*************9889999*************************************99.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  lvg++ktLvfy+gr+pkg+ktdWvmhe+rl
  AT3G12977.1 114 LVGMRKTLVFYRGRSPKGRKTDWVMHEFRL 143
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-5910168IPR003441NAC domain
PROSITE profilePS5100555.51618167IPR003441NAC domain
PfamPF023651.0E-2519143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEETEKNKGS ISMVEANLPP GFRFHPRDDE LVCDYLMRRT VRSLYQPVVL IDVDLNKCEP  60
WDIPQTARVG GKEWYFYSQK DRKYATGYRT NRATATGYWK ATGKDRAIQR NGGLVGMRKT  120
LVFYRGRSPK GRKTDWVMHE FRLQGKLLHH SPNSLEEEWV LCRVFHKNSN GADIDDITRS  180
CSDATASAFM DSYINFDHHH IINQHVPCFS NNLSHNQTNQ SGLISKNSSP LFNASPDQMI  240
LRTLLSQLTK KVEESQSRGD GSSESQLTDI GIPSHAWNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-501416911170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT3G12977
AtGenExpressAT3G12977
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G12977.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G12977
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266450.0AB026645.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MGH6.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001030683.20.0NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
SwissprotQ84TE61e-130NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLQ9LSI10.0Q9LSI1_ARATH; NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
STRINGAT3G12977.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36192859
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]