PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7DL_C343BA649.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 185aa MW: 20467.9 Da PI: 10.2444 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 43.8 | 5.5e-14 | 80 | 132 | 3 | 55 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 + +r rr+ +NRe+ArrsR+RK a++ Le v++L++e +L k+l e +++ Traes_7DL_C343BA649.2 80 DTRRIRRMVSNRESARRSRRRKHAQLTDLELQVEQLKSESATLFKQLTEANQQ 132 56899***************************************777776665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.5E-13 | 78 | 142 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.749 | 80 | 132 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.5E-11 | 81 | 132 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.68E-11 | 82 | 134 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 3.2E-12 | 82 | 133 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 85 | 100 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
QNALELQESN AGHVWWSDGL RAPQHHAVPT PTQSQTPAVS ASPRETISGN QALETESDSD 60 SESLVEIGGG RCKRSGKSSD TRRIRRMVSN RESARRSRRR KHAQLTDLEL QVEQLKSESA 120 TLFKQLTEAN QQFTTAVTDN RILKSDVETL RIKVKMAEDM VARGAVSCGL GQQLGLAPFL 180 NSRKM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that possesses broad binding specificity for DNA promoter elements with the core sequence 5'-ACGT-3'. May be involved in the regulation of genes expressed during seed development (PubMed:7919992). Binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters (PubMed:11133985). {ECO:0000269|PubMed:11133985, ECO:0000269|PubMed:7919992}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK361338 | 0.0 | AK361338.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1138D02. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020167700.1 | 1e-132 | basic leucine zipper 9-like isoform X1 | ||||
Swissprot | Q6ETX0 | 3e-61 | RSBZ3_ORYSJ; bZIP transcription factor RISBZ3 | ||||
TrEMBL | A0A3B6TRJ2 | 1e-131 | A0A3B6TRJ2_WHEAT; Uncharacterized protein | ||||
TrEMBL | A0A453T1I0 | 1e-131 | A0A453T1I0_AEGTS; Uncharacterized protein | ||||
TrEMBL | M8AMI0 | 1e-131 | M8AMI0_AEGTA; Regulatory protein opaque-2 | ||||
STRING | Traes_7DL_C343BA649.2 | 1e-133 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2095 | 37 | 96 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G24800.1 | 2e-28 | basic leucine zipper 9 |
Publications ? help Back to Top | |||
---|---|---|---|
|