| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | bZIP_1 | 54.7 | 2.2e-17 | 120 | 171 | 3 | 54 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54
+lkr rr+ +NRe+A+rsR+RK++++ Le+ v++L++ N++L k+l ++
AT5G24800.1 120 DLKRIRRMNSNRESAKRSRRRKQEYLVDLETQVDSLKGDNSTLYKQLIDATQ 171
79*****************************************988765555 PP
|
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
Science, 2000. 290(5499): p. 2105-10
[PMID:11118137] - Jakoby M, et al.
bZIP transcription factors in Arabidopsis.
Trends Plant Sci., 2002. 7(3): p. 106-11
[PMID:11906833] - Zik M,Irish VF
Global identification of target genes regulated by APETALA3 and PISTILLATA floral homeotic gene action.
Plant Cell, 2003. 15(1): p. 207-22
[PMID:12509532] - Vincentz M,Bandeira-Kobarg C,Gauer L,Schl
Evolutionary pattern of angiosperm bZIP factors homologous to the maize Opaque2 regulatory protein.
J. Mol. Evol., 2003. 56(1): p. 105-16
[PMID:12569427] - Lara P, et al.
Synergistic activation of seed storage protein gene expression in Arabidopsis by ABI3 and two bZIPs related to OPAQUE2.
J. Biol. Chem., 2003. 278(23): p. 21003-11
[PMID:12657652] - Rizhsky L, et al.
When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress.
Plant Physiol., 2004. 134(4): p. 1683-96
[PMID:15047901] - Deppmann CD, et al.
Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
Nucleic Acids Res., 2004. 32(11): p. 3435-45
[PMID:15226410] - Guan Y,Nothnagel EA
Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures.
Plant Physiol., 2004. 135(3): p. 1346-66
[PMID:15235117] - Ehlting J, et al.
Global transcript profiling of primary stems from Arabidopsis thaliana identifies candidate genes for missing links in lignin biosynthesis and transcriptional regulators of fiber differentiation.
Plant J., 2005. 42(5): p. 618-40
[PMID:15918878] - Oono Y, et al.
Monitoring expression profiles of Arabidopsis genes during cold acclimation and deacclimation using DNA microarrays.
Funct. Integr. Genomics, 2006. 6(3): p. 212-34
[PMID:16463051] - Truman W,de Zabala MT,Grant M
Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance.
Plant J., 2006. 46(1): p. 14-33
[PMID:16553893] - Lee JY, et al.
Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots.
Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60
[PMID:16581911] - Ehlert A, et al.
Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors.
Plant J., 2006. 46(5): p. 890-900
[PMID:16709202] - Deppmann CD,Alvania RS,Taparowsky EJ
Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
Mol. Biol. Evol., 2006. 23(8): p. 1480-92
[PMID:16731568] - Weltmeier F, et al.
Combinatorial control of Arabidopsis proline dehydrogenase transcription by specific heterodimerisation of bZIP transcription factors.
EMBO J., 2006. 25(13): p. 3133-43
[PMID:16810321] - Osuna D, et al.
Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
Plant J., 2007. 49(3): p. 463-91
[PMID:17217462] - Popescu SC, et al.
Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays.
Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5
[PMID:17360592] - Cheng C, et al.
An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
BMC Genomics, 2007. 8: p. 175
[PMID:17577400] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
Plant Physiol., 2008. 148(1): p. 436-54
[PMID:18650403] - Weltmeier F, et al.
Expression patterns within the Arabidopsis C/S1 bZIP transcription factor network: availability of heterodimerization partners controls gene expression during stress response and development.
Plant Mol. Biol., 2009. 69(1-2): p. 107-19
[PMID:18841482] - Kirchler T, et al.
The role of phosphorylatable serine residues in the DNA-binding domain of Arabidopsis bZIP transcription factors.
Eur. J. Cell Biol., 2010 Feb-Mar. 89(2-3): p. 175-83
[PMID:20047775] - Kang SG,Price J,Lin PC,Hong JC,Jang JC
The arabidopsis bZIP1 transcription factor is involved in sugar signaling, protein networking, and DNA binding.
Mol Plant, 2010. 3(2): p. 361-73
[PMID:20080816] - Causier B,Ashworth M,Guo W,Davies B
The TOPLESS interactome: a framework for gene repression in Arabidopsis.
Plant Physiol., 2012. 158(1): p. 423-38
[PMID:22065421] - Song QX, et al.
Soybean GmbZIP123 gene enhances lipid content in the seeds of transgenic Arabidopsis plants.
J. Exp. Bot., 2013. 64(14): p. 4329-41
[PMID:23963672] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Veerabagu M, et al.
The interaction of the Arabidopsis response regulator ARR18 with bZIP63 mediates the regulation of PROLINE DEHYDROGENASE expression.
Mol Plant, 2014. 7(10): p. 1560-77
[PMID:24948556] - Ortiz-Espín A, et al.
Mitochondrial AtTrxo1 is transcriptionally regulated by AtbZIP9 and AtAZF2 and affects seed germination under saline conditions.
J. Exp. Bot., 2017. 68(5): p. 1025-1038
[PMID:28184497] - Ezer D, et al.
The G-Box Transcriptional Regulatory Code in Arabidopsis.
Plant Physiol., 2017. 175(2): p. 628-640
[PMID:28864470] - Pedrotti L, et al.
Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
Plant Cell, 2018. 30(2): p. 495-509
[PMID:29348240]
|
