PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BS_54E859139.1
Organism
Triticum aestivum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family GRAS
Protein Properties Length: 76aa    MW: 8432.48 Da    PI: 9.2837
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BS_54E859139.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS51.61.8e-16247226272
                   GRAS 226 evLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                            +vL +v+ ++P++v+vveqe +hns++Fl+rf+e  +yys++fds+ 
  Traes_7BS_54E859139.1   2 KVLGTVRAVRPRIVTVVEQEGNHNSGTFLDRFTEH-YYYSTMFDSWT 47 
                            69*******************************97.699******94 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509859.057176IPR005202Transcription factor GRAS
PfamPF035146.3E-14247IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
EKVLGTVRAV RPRIVTVVEQ EGNHNSGTFL DRFTEHYYYS TMFDSWTRCT TTPPCSIPSR  60
AAAPAAHPKS HRGAAV
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. Acts as a negative regulator of GAMYB gene expression. {ECO:0000269|PubMed:12011349, ECO:0000269|PubMed:12011350, ECO:0000269|PubMed:12468736}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFM8789453e-58FM878945.1 Triticum aestivum Rht-Ble gene for mutated DELLA protein.
GenBankFR6685863e-58FR668586.2 Triticum aestivum rht-B1 gene, allele a.
GenBankFR6685873e-58FR668587.1 Triticum aestivum rht-B1 gene, allele h.
GenBankFR6685883e-58FR668588.1 Triticum aestivum rht-B1 gene, allele i.
GenBankFR6685893e-58FR668589.1 Triticum aestivum rht-B1 gene, allele j.
GenBankFR7197323e-58FR719732.1 Triticum aestivum rht-B1a gene for DELLA protein.
GenBankGQ4513353e-58GQ451335.2 Triticum aestivum cultivar Xiaoyan 54 truncated DELLA protein RHT-B1b gene, complete cds.
GenBankJF9302783e-58JF930278.1 Triticum aestivum DELLA protein (Rht-B1) gene, Rht-B1a allele, complete cds.
GenBankJF9302793e-58JF930279.1 Triticum aestivum DELLA protein (Rht-B1) gene, Rht-B1c allele, complete cds.
GenBankJF9302803e-58JF930280.1 Triticum aestivum DELLA protein (Rht-B1) gene, Rht-B1e allele, complete cds.
GenBankJN8579703e-58JN857970.1 Triticum aestivum mutant DELLA protein gene, complete cds.
GenBankJN8579713e-58JN857971.1 Triticum aestivum mutant DELLA protein mRNA, complete cds.
GenBankKC6146143e-58KC614614.1 Triticum aestivum cultivar Robigus bio-material NIAB EW66-3 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds.
GenBankKC6146153e-58KC614615.1 Triticum aestivum cultivar Siete Cerros bio-material JIC:614 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds.
GenBankKC6146163e-58KC614616.1 Triticum aestivum cultivar Soissons bio-material NIAB EW9 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds.
GenBankKC6146173e-58KC614617.1 Triticum aestivum cultivar W7984 bio-material INRA:13812 haplotype Rht-B1b_1 truncated DELLA protein (Rht-B1) gene, Rht-B1b allele, complete cds.
GenBankKC7679253e-58KC767925.1 Triticum aestivum cultivar Sumai 3 DELLA (Rht-B1) gene, Rht-B1a allele, complete cds.
GenBankKC7679263e-58KC767926.1 Triticum aestivum cultivar Sumai 3 DELLA (Rht-B1) gene, Rht-B1c allele, complete cds.
GenBankKF2826283e-58KF282628.1 Triticum durum cultivar Langdon clone BAC 315P18 chromosome 4B DELLA protein (Rht-B) gene, complete cds, complete sequence.
GenBankKT0132633e-58KT013263.1 Triticum aestivum truncated DELLA protein RHT-B1 (Rht-B1) gene, Rht-B1-p allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001354393.12e-19DELLA protein DWARF8
RefseqXP_002466594.12e-19DELLA protein DWARF8
SwissprotQ8W1276e-21SLN1_HORVU; DELLA protein SLN1
TrEMBLA0A446R8Q74e-19A0A446R8Q7_TRITD; Uncharacterized protein
TrEMBLA0A446RRP65e-19A0A446RRP6_TRITD; Uncharacterized protein
STRINGTraes_7BS_54E859139.12e-50(Triticum aestivum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.17e-16GRAS family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]