PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BL_7E32A8329.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family HB-other
Protein Properties Length: 54aa    MW: 6490.53 Da    PI: 9.8085
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BL_7E32A8329.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.5e-108402254
                           SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54
                            ryp+ +e+  LA++ gL+ +qV++WF N R +
  Traes_7BL_7E32A8329.1  8 ARYPKDHEKDMLAARSGLSRSQVSNWFINARVR 40
                           59*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.398144IPR001356Homeobox domain
SMARTSM003890.003348IPR001356Homeobox domain
SuperFamilySSF466896.42E-13851IPR009057Homeodomain-like
CDDcd000863.39E-8945No hitNo description
PfamPF059202.1E-131040IPR008422Homeobox KN domain
Gene3DG3DSA:1.10.10.601.9E-171050IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 54 aa     Download sequence    Send to blast
TDLLIPRARY PKDHEKDMLA ARSGLSRSQV SNWFINARVR LWKPMIEEMY EELK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in the signal transduction pathway downstream of the COP1 gene. Controls floral competency as a specific activator of FLC expression. Is responsive of the nuclear import of SHOOT MERISTEMLESS (STM). {ECO:0000269|PubMed:17908157}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. In etiolated seedlings, maximally expressed after 3 days of illumination.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5466442e-67AB546644.1 Triticum aestivum WBLH2-1 mRNA for BEL1-type homeodomain protein, complete cds.
GenBankAB5466452e-67AB546645.1 Triticum aestivum WBLH2-2 mRNA for BEL1-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020196798.12e-24BEL1-like homeodomain protein 2
SwissprotP487318e-20ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A287X7Y59e-27A0A287X7Y5_HORVV; Uncharacterized protein
STRINGTraes_7BL_7E32A8329.19e-33(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77153146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.13e-22homeobox gene 1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]