PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_7BL_7E32A8329.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | HB-other | ||||||||
Protein Properties | Length: 54aa MW: 6490.53 Da PI: 9.8085 | ||||||||
Description | HB-other family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 30.1 | 8.5e-10 | 8 | 40 | 22 | 54 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 ryp+ +e+ LA++ gL+ +qV++WF N R + Traes_7BL_7E32A8329.1 8 ARYPKDHEKDMLAARSGLSRSQVSNWFINARVR 40 59*****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50071 | 10.398 | 1 | 44 | IPR001356 | Homeobox domain |
SMART | SM00389 | 0.003 | 3 | 48 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 6.42E-13 | 8 | 51 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 3.39E-8 | 9 | 45 | No hit | No description |
Pfam | PF05920 | 2.1E-13 | 10 | 40 | IPR008422 | Homeobox KN domain |
Gene3D | G3DSA:1.10.10.60 | 1.9E-17 | 10 | 50 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 54 aa Download sequence Send to blast |
TDLLIPRARY PKDHEKDMLA ARSGLSRSQV SNWFINARVR LWKPMIEEMY EELK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor which may be involved in the signal transduction pathway downstream of the COP1 gene. Controls floral competency as a specific activator of FLC expression. Is responsive of the nuclear import of SHOOT MERISTEMLESS (STM). {ECO:0000269|PubMed:17908157}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By light. In etiolated seedlings, maximally expressed after 3 days of illumination. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB546644 | 2e-67 | AB546644.1 Triticum aestivum WBLH2-1 mRNA for BEL1-type homeodomain protein, complete cds. | |||
GenBank | AB546645 | 2e-67 | AB546645.1 Triticum aestivum WBLH2-2 mRNA for BEL1-type homeodomain protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020196798.1 | 2e-24 | BEL1-like homeodomain protein 2 | ||||
Swissprot | P48731 | 8e-20 | ATH1_ARATH; Homeobox protein ATH1 | ||||
TrEMBL | A0A287X7Y5 | 9e-27 | A0A287X7Y5_HORVV; Uncharacterized protein | ||||
STRING | Traes_7BL_7E32A8329.1 | 9e-33 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP7715 | 31 | 46 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G32980.1 | 3e-22 | homeobox gene 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|