Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 25.6 | 2.1e-08 | 391 | 429 | 18 | 54 |
HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
Homeobox 18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54
+F++ ++yp+ +e+ LA + gLt +qV++WF N R +
AT4G32980.1 391 MFQNflHPYPKDSEKHLLAIRSGLTRSQVSNWFINARVR 429
6887779******************************88 PP
|
2 | BELL | 93.3 | 2.3e-30 | 266 | 336 | 1 | 72 |
BELL 1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
+r++l++kk++Ll+ll++Vd+rY+++v++++tvis+F+a+++l++ +++t++Al+++S+ +++L+++i+++i
AT4G32980.1 266 QRRALEAKKTHLLDLLQMVDDRYSHCVDEIHTVISAFHAATELDP-QLHTRFALQTVSFLYKNLRERICKKI 336
6899*****************************************.************************98 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - García-Martinez JL,Gil J
Light Regulation of Gibberellin Biosynthesis and Mode of Action. J. Plant Growth Regul., 2001. 20(4): p. 354-368 [PMID:11986761] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Smith HM,Campbell BC,Hake S
Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH. Curr. Biol., 2004. 14(9): p. 812-7 [PMID:15120075] - Gómez-Mena C,de Folter S,Costa MM,Angenent GC,Sablowski R
Transcriptional program controlled by the floral homeotic gene AGAMOUS during early organogenesis. Development, 2005. 132(3): p. 429-38 [PMID:15634696] - Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins. Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12 [PMID:15781858] - Viola IL,Gonzalez DH
Interaction of the BELL-like protein ATH1 with DNA: role of homeodomain residue 54 in specifying the different binding properties of BELL and KNOX proteins. Biol. Chem., 2006. 387(1): p. 31-40 [PMID:16497162] - Cole M,Nolte C,Werr W
Nuclear import of the transcription factor SHOOT MERISTEMLESS depends on heterodimerization with BLH proteins expressed in discrete sub-domains of the shoot apical meristem of Arabidopsis thaliana. Nucleic Acids Res., 2006. 34(4): p. 1281-92 [PMID:16513846] - Welch D, et al.
Arabidopsis JACKDAW and MAGPIE zinc finger proteins delimit asymmetric cell division and stabilize tissue boundaries by restricting SHORT-ROOT action. Genes Dev., 2007. 21(17): p. 2196-204 [PMID:17785527] - Proveniers M,Rutjens B,Brand M,Smeekens S
The Arabidopsis TALE homeobox gene ATH1 controls floral competency through positive regulation of FLC. Plant J., 2007. 52(5): p. 899-913 [PMID:17908157] - Gómez-Mena C,Sablowski R
ARABIDOPSIS THALIANA HOMEOBOX GENE1 establishes the basal boundaries of shoot organs and controls stem growth. Plant Cell, 2008. 20(8): p. 2059-72 [PMID:18757555] - Rutjens B, et al.
Shoot apical meristem function in Arabidopsis requires the combined activities of three BEL1-like homeodomain proteins. Plant J., 2009. 58(4): p. 641-54 [PMID:19175771] - Li Y,Pi L,Huang H,Xu L
ATH1 and KNAT2 proteins act together in regulation of plant inflorescence architecture. J. Exp. Bot., 2012. 63(3): p. 1423-33 [PMID:22140242] - Schmid MW, et al.
A powerful method for transcriptional profiling of specific cell types in eukaryotes: laser-assisted microdissection and RNA sequencing. PLoS ONE, 2012. 7(1): p. e29685 [PMID:22291893] - Khan M,Tabb P,Hepworth SR
BLADE-ON-PETIOLE1 and 2 regulate Arabidopsis inflorescence architecture in conjunction with homeobox genes KNAT6 and ATH1. Plant Signal Behav, 2012. 7(7): p. 788-92 [PMID:22751300] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Khan M, et al.
Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] - Quaedvlieg N,Dockx J,Rook F,Weisbeek P,Smeekens S
The homeobox gene ATH1 of Arabidopsis is derepressed in the photomorphogenic mutants cop1 and det1. Plant Cell, 1995. 7(1): p. 117-29 [PMID:7696878] - van Drunen CM, et al.
Analysis of the chromatin domain organisation around the plastocyanin gene reveals an MAR-specific sequence element in Arabidopsis thaliana. Nucleic Acids Res., 1997. 25(19): p. 3904-11 [PMID:9380515]
|